SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014897 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014897
Domain Number 1 Region: 166-423
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.37e-81
Family Eukaryotic proteases 0.000000000716
Further Details:      
 
Domain Number 2 Region: 48-161
Classification Level Classification E-value
Superfamily Kringle-like 2.05e-32
Family Kringle modules 0.00000563
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014897   Gene: ENSGGOG00000015266   Transcript: ENSGGOT00000015322
Sequence length 431
Comment pep:known_by_projection chromosome:gorGor3.1:10:86552125:86558570:1 gene:ENSGGOG00000015266 transcript:ENSGGOT00000015322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLARLLLCVLVVSYSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQ
HCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLAWNSATVLQQTYHAHRSDALQLGLGKHN
YCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKII
GGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLG
RSTLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICL
PSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHWECQQPHYYGSEVTTKML
CAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR
SHTKGENGLAL
Download sequence
Identical sequences G3RGY4
XP_004049656.1.27298 ENSGGOP00000014897 ENSGGOP00000014897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]