SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014933 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014933
Domain Number 1 Region: 780-985
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000146
Family WD40-repeat 0.026
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014933
Domain Number - Region: 385-438
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00196
Family RILP dimerisation region 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014933   Gene: ENSGGOG00000015297   Transcript: ENSGGOT00000015360
Sequence length 1130
Comment pep:known_by_projection chromosome:gorGor3.1:5:32909673:33030079:1 gene:ENSGGOG00000015297 transcript:ENSGGOT00000015360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFIEFEDSQEQEKKDLQTRVESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQ
RHTEMIHNYMEHLERTKLHQLSGSDQLESTAHSRIRKERPISLGIFPLPAGDGLLTPDAQ
KGGETPGSEQWKFQELSQPRSHTSLKVSNSPEPQKAVEQEDELSDVSQGGSKATTPASTA
NSDVATIPTDTPLKEENEGFVKVTDVPNKSEISKHIEVQVAQETRNVSTGSAENEEKSEV
QAIIESTPELDMDKDLSGYKGSSTPTKGIENKAFDRNTESLFEELSSAGSGLIGDVDEGA
DLLGMGREVENLILENTQLLETKNALNIVKNDLIAKVDELTCEKDVLQGELEAVKQAKLK
LEEKNRELEEELRSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASR
ENPAMQEKKRSSIWQFFSRLFSSSSNTTKKPEPPVNLKYNAPTSHVTPSVKKRSSTLSQL
PGDKSKAFDFLSEETEASLASRREQKREQYRQVKAHVQKEDGRVQAFGWSLPQKYKQVTN
GQGENKMKNLPVPVYLRPLDEKDTSMKKLWCAVGVNLSGGKTRDGGSVVGASVFYKDVAG
LDTEGSKQRSASQSSLDKLDQELKEQQKELKNQEELSSLVWICTSTHSATKVLIIDAVQP
GNILDSFTVCNSHVLCIASVPEMEAENSEVDENVPTAEEATEATEGNAGSAEDTVDISQT
GVYTEHVFTDPLGVQIPEDLSPVYQSSNDSDAYKDQISVLPNEQDLVREEAQKMSSLLPT
MWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVDG
QWDLSNYHLLDLGRPHHSIRCMTVVHDKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQ
VRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITAL
MVSCNRLWVGTGNGVIISIPLTETNKTSGVPGNRPGSVIRVYGDENSDKVTPGTFIPYCS
MAHAQLCFHGHRDAVKFFVAVPGQVISPQSSSSGTDLTGDKAGPSAQEPGSQTPLKSMLV
ISGGEGYIDFRMGDEGGESELLGEDLPLEPSVTKAERSHLIVWQVMYGSE
Download sequence
Identical sequences ENSGGOP00000014933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]