SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015019 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015019
Domain Number 1 Region: 362-464
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.95e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 173-227,254-269,297-315
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.95e-16
Family BphP N-terminal domain-like 0.051
Further Details:      
 
Domain Number 3 Region: 91-174
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000275
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 4 Region: 570-734
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.000000000671
Family Tetraviridae-like VP 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015019   Gene: ENSGGOG00000015383   Transcript: ENSGGOT00000015448
Sequence length 790
Comment pep:known_by_projection chromosome:gorGor3.1:1:129698178:129746433:-1 gene:ENSGGOG00000015383 transcript:ENSGGOT00000015448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGISRTSTEMTSDVPSLGPAIASGNPGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFL
RCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLK
TGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGE
PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQP
TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
QVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQ
RPQLGPTANLPLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSK
PLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENF
RNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGAAPTWTPTTRSGFSAQQVATQATAKT
RTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTA
EGVGVWPQWQGQQPHHRSSSSEQHVQQPPAQQPGQPEVFQQEMLSMLGDQSNSYNNEEFP
DLTMFPPFSE
Download sequence
Identical sequences ENSGGOP00000015019 ENSGGOP00000025461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]