SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015277 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015277
Domain Number 1 Region: 572-862
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-84
Family Protein kinases, catalytic subunit 0.0000000000452
Further Details:      
 
Domain Number 2 Region: 120-210
Classification Level Classification E-value
Superfamily Immunoglobulin 8.02e-25
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 27-126
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-19
Family I set domains 0.025
Further Details:      
 
Domain Number 4 Region: 205-294
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000203
Family I set domains 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015277
Domain Number - Region: 323-409
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.000314
Family Frizzled cysteine-rich domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015277   Gene: ENSGGOG00000015657   Transcript: ENSGGOT00000015713
Sequence length 875
Comment pep:known_by_projection chromosome:gorGor3.1:9:93112069:93248125:1 gene:ENSGGOG00000015657 transcript:ENSGGOT00000015713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRELVNIPLVHILTLVAFSGTEKLPKAPVITTPLETVDALVEEVATFMCAVESYPQPEIS
WTRNKILIKLFDTRYSIRENGQLLTILSVEDSDDGVYCCTANNGVGGAVESCGALQVKMK
PKITRPPINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDSPLRENSRIAVLESGSLRIHNV
QKEDAGQYRCVAKNSLGTAYSKVVKLEVEVFARILRAPESHNVTFGSFVTLHCTATGIPV
PTITWIENGNAVSSGSIQESVKDRVIDSRLQLFITKPGLYTCIATNKHGEKFSTAKAAAT
ISIAEMLFISSFSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHT
AWNELKAVSPVCRPAAEALLCNHIFQECSPGIVPTPIPICREYCLAVKELFCAKEWLVME
EKTHRGLYRSEMHLLSVPECSKLPSMHWDPRACARLPHLDYNKENLKTFPPMTSSKPSVD
IPNLPSSSSSSFSVSPTYSMTVIISIMSSFAIFVLLTITTLYCCRRRKQWKNKKRESAAV
TLTTLPSELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARA
PGLLPYEPFTMVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPMCLL
FEYMAYGDLNEFLRSMSPHTVCSLSHSDLSMRAQVSSPGPPPLSCAEQLCIARQVAAGMA
YLSERKFVHRDLATRNCLVGENMVVKIADFGLSRNIYSADYYKANENDAIPIRWMPPESI
FYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILSCPENCPVELYNL
MRLCWSKLPADRPSFTSIHRILERMCERAEGAVSV
Download sequence
Identical sequences ENSGGOP00000015277 ENSGGOP00000015277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]