SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015315 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015315
Domain Number 1 Region: 191-303
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-17
Family Spermadhesin, CUB domain 0.0048
Further Details:      
 
Domain Number 2 Region: 398-436
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 3 Region: 139-176
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 4 Region: 35-134
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000131
Family Spermadhesin, CUB domain 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015315
Domain Number - Region: 328-353
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000183
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number - Region: 356-397
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00131
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015315   Gene: ENSGGOG00000015695   Transcript: ENSGGOT00000015752
Sequence length 713
Comment pep:known_by_projection chromosome:gorGor3.1:14:3855157:3861488:1 gene:ENSGGOG00000015695 transcript:ENSGGOT00000015752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSATLLLLLLGGALAHPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWL
ILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPPISLCEAPPSPLQLPGGNVTITYSYAG
ARAPTGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFP
GLTPRPVPSLPCNLTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALD
LGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNA
TYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGH
FPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDG
QPDCADGSDEWDCSYVLPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAPL
SRMEAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPGG
GPGARRRQRGRLMRRLVRRLRRWGLLPRTNTPARASEARSQVTPSAAPLEALDSGTGPAR
EGGAVGGQDGEQAPPLPIKAPLPSASTSPAPTTVPEAPGPLPSLPLEPSLLSGVVQALRG
RLLPSLGPPGPTRSPPGPHTAVLALEDEDDVLLVPLAEPGVWVAEAEDEPLLT
Download sequence
Identical sequences A0A2I2YVZ8
ENSGGOP00000015315 ENSGGOP00000015315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]