SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015321 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015321
Domain Number 1 Region: 135-231
Classification Level Classification E-value
Superfamily Immunoglobulin 8.12e-25
Family I set domains 0.015
Further Details:      
 
Domain Number 2 Region: 509-701
Classification Level Classification E-value
Superfamily Fibronectin type III 1.73e-24
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 3 Region: 228-324
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-21
Family I set domains 0.014
Further Details:      
 
Domain Number 4 Region: 28-143
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000242
Family I set domains 0.032
Further Details:      
 
Domain Number 5 Region: 410-507
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000375
Family I set domains 0.015
Further Details:      
 
Domain Number 6 Region: 327-424
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000528
Family I set domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015321   Gene: ENSGGOG00000015705   Transcript: ENSGGOT00000015758
Sequence length 1349
Comment pep:known_by_projection chromosome:gorGor3.1:11:132275844:132317140:-1 gene:ENSGGOG00000015705 transcript:ENSGGOT00000015758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIWYVATFIASVIGTRGLAAQGAHGLREEPEFVTARAGESVVLRCDVIHPVTGQPPPYVV
EWFKFGVPIPIFIKFGYYPPHVDPEYAGRASLHDKASLRLEQVRSEDQGWYECKVLMLDQ
QYDTFHNGSWVHLTINAPPTFTETPPQYIEAKEGGSITMTCTAFGNPKPIVTWLKEGTLL
GASGKYQVSDGSLTVTSVSREDRGAYTCRAYSIQGEAVHTTHLLVQGPPFIVSPPENITV
NISQDALLTCRAEAYPGNLTYTWYWQDENVYFQNDLKLRVRILIDGTLIIFRVKPEDSGK
YTCVPSNSLGRSPSASAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEPPATVVKWN
KDGRPLQVEKNLGWTLMEDGSIRIEEATEEALGTYTCVPYNTLGTMGQSAPARLVLKDPP
YFTVLPGWEYRQEAGRELLIPCAAAGDPFPVITWRKVGKPSRSKHSALPSGSLQFRALSK
EDHGEWECVATNVVTSITASTHLTVIGTSPHAPGSVRVQVSMTTANVSWEPGYDGGYEQT
FSVWMKRAQFGPHDWLSLPVPPGPSWLLVDTLEPETTYQFSVLAQNKLGTSAFSEVVTVN
TLAFPITTPEPLVLVTPPRCLIANRTQQGVLLSWLPPANHSFPIDRYIMEFRVAERWELL
DDGIPGTEGEFFAKDLSQDTWYEFRVLAVMQDLISEPSNIAGVSSTDIFPQPDLTEDGLA
RPVLAGIVATICFLAAAILFSTLAACFVNKQRKRKLKRKKDPPLSITHCRKSLESPLSSG
KVSPESIRTLRAPSESSDDQGQPAAKRMLSPTREKELSLYKKTKRAISSKKYSVAKAEAE
AEATTPIELISRGPDGRFVMDPAEMEPSLKSRRIEGFPFAEETDMYPEFRQSDEENEDPL
VPTSVAALKSQLTPLSSSQESYLPPPAYSPRFQPRGLEGPGGLEGRLQATGQARPPAPRP
FHHGQYYGYLSSSSPGEVEPPPFYVPEVGSPLSSVMSSPPLPTEGPFGHPTIPEENGENA
SNSTLPLTQTPTGGRSPEPWGRPEFPFGGLETPAMMFPHQLPPCDVPESLQPKAGLPRGL
PPTSLQVPAAYPGILSLEAPKVWAGKSPGRGPVPAPPAAKWQDRPMQPLVSQGQLRHTSQ
GMGIPVLPYPEPAEPGAHGGPSTFGLDTRWYEPQPRPRPSPRQARRAEPSLHQVVLQPSR
LSPLTQSPLSSRTGSPELAARARPRPGLLQQAEMSEITLQPPAAVSFSRKSTPSTGSPSQ
SSRSGSPSYRPAVGFTTLATGYPSPPPGPAPAGPGDSLDVFGQTPSPRRTGEELLRPEPP
PPTLPTSGKLQRDRRAPATSPPERALSKL
Download sequence
Identical sequences G3RSZ0
ENSGGOP00000015321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]