SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015345 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015345
Domain Number 1 Region: 15-349
Classification Level Classification E-value
Superfamily ALDH-like 1.3e-104
Family ALDH-like 0.0000000058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015345   Gene: ENSGGOG00000015729   Transcript: ENSGGOT00000015784
Sequence length 384
Comment pep:known_by_projection chromosome:gorGor3.1:11:64586832:64590576:-1 gene:ENSGGOG00000015729 transcript:ENSGGOT00000015784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDERSTNLFMKLDSVFIRKEPFGLVLIIAPWNYPLNLTLVPLVGALAAGNCVVLKPSEI
SQGTEKVLAEVLPQYLDQSCFAMVLGGPQETGQLLQHKLDYIFFMGSPRVGKIVMTAATK
YLTPVTLELGGKNPCYVDDNCDPQTMANPVAWFRYFNAGQTCVAPDYVLCSPEMQERLLP
ALQSTITRFYGDNPQSSPNLGRIINQKQFQRLRALLGCGRVAIGGQSNESDCYIAPTVLV
DVQETEPVMQEEIFRPILPIVNVQSVDEAIEFINRREKPLALYAFSNSSQVVNQMLERTS
SGSFGGNEGFTYISLLSVPFGGVGHSGMGRYHGKFTFDTFSHHRTCLLAPSGLEKLKEIR
YPPYTDWNQQLLRWGMGSQSCTLL
Download sequence
Identical sequences ENSGGOP00000015345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]