SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015436 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015436
Domain Number 1 Region: 258-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.27e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 217-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000282
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 162-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000422
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015436   Gene: ENSGGOG00000015828   Transcript: ENSGGOT00000015881
Sequence length 331
Comment pep:known_by_projection chromosome:gorGor3.1:9:116574189:116593414:1 gene:ENSGGOG00000015828 transcript:ENSGGOT00000015881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSFLVKSKKAHTYHQPRVQEDEPLWPPALTPVPRDQAPSNGPVLSTLFPNQCLDWTNL
KREPELEQDQNLARMAPAPEGPIVLSRPQDGDSPLSDSPPFYKPSFSWDTLATTYGHSYR
QAPSTMQSAFLEHSVSLYGSPLVPSTEPALDFSLRYSPGMDAYHCVKCNKVFSTPHGLEV
HVRRSHSGTRPFACDICGKTFGHAVSLEQHTHVHSQQERSFECRMCGKAFKRSSTLSTHL
LIHSDTRPYPCQFCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHT
GFKPFSCELCTKGFQRKVDLRRHRESQHNLK
Download sequence
Identical sequences ENSGGOP00000015436 ENSGGOP00000015436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]