SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015446 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015446
Domain Number 1 Region: 2437-2630
Classification Level Classification E-value
Superfamily BRCA2 helical domain 6.93e-88
Family BRCA2 helical domain 0.0000000271
Further Details:      
 
Domain Number 2 Region: 3015-3147
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.26e-54
Family Single strand DNA-binding domain, SSB 0.00000579
Further Details:      
 
Domain Number 3 Region: 2829-2930
Classification Level Classification E-value
Superfamily BRCA2 tower domain 5.49e-36
Family BRCA2 tower domain 0.0000181
Further Details:      
 
Domain Number 4 Region: 2632-2742
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.31e-35
Family Single strand DNA-binding domain, SSB 0.00000328
Further Details:      
 
Domain Number 5 Region: 2932-3014
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.31e-23
Family Single strand DNA-binding domain, SSB 0.00004
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015446
Domain Number - Region: 1664-1750
Classification Level Classification E-value
Superfamily AbfB domain 0.0575
Family AbfB domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015446   Gene: ENSGGOG00000015808   Transcript: ENSGGOT00000015891
Sequence length 3333
Comment pep:known_by_projection chromosome:gorGor3.1:13:14169243:14260948:1 gene:ENSGGOG00000015808 transcript:ENSGGOT00000015891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPIGSKERPTFFEIFKTRCNKAVDLGPISLNWFEELSSEAPPYNSEPAEESEHKNNNYEP
NLFKTPQRKPSYNQLASTPIIFKEQGLTLPLYQSPVKELGRNVPNSRHKSLRTVKTKMDQ
ADDVSCPLLNSCLSESPVVLQCTHVTPQRDKSVVCGSLFHTPKFVKGRQTPKHISESLGA
EVDPDMSWSSSLATPPTLSSTVLIVRNEEASETVFPHDTTANVKSYFSNHDESLKKNDRF
IASVTDSENTNQREATSHGFGKTSGNSFKVNSCKDHIGKSMPNVLEDEVYETVVDTSEED
SFSLCFSKCRTKNLQKVRTSKTRKKISHEANADECEKSKNQVKEKYSFVSEVEPNDTDPL
DSNVANQKPFESGSDKISKEVVPSLACEWSQLTLSGLNGAQMEKIPLLNISSCDQNISEK
DLLDTENKRKKDFLTSENSLPRISSLPKSEKPLNEETVVNKRDEEQHLESHTDCILAVKQ
AISGTSPVASSFQGIKKSIFRIRESPKETFGASFSGHMTDPNFKKETEASESGLEIHTVC
SQKEDSLCPNLIDNGSWPATTTQTSVALKNAGLISTLKKKTNKFIYAIHDETSYKGKKIP
KDQKSELINCSAQFEANAFEAPLTFANADSGLLHSSVKRSCSQNDSEEPTLSLTSSFGTI
LRNETCSNDTVISQDLDYKEAKCNKEKLQLFITPEADSLSCLQEGQCENDPKSKKVSDIK
EEVLAAACHPVQHSKVEYSDTDFQSQKSLLYDHENASTLILTPTSKDVLSNLVMISRGKE
SYKMSDKLKGNNYESDVELTKNIPMEKNQDVCALNENYKNVELLPPEKYMRVASPSRKVQ
FNQNTNLRVIQKNQEETTSISKITVNPDSEELFSDNENNFVFQVANERNNLALGNTKELH
ETDLTCVNEPIFKNPTMVLYGDTGDKQATQVSIKKDLVYVLAEENKNSVKQHIKMTLGQD
LKSDISLNIDKIPDKNNDYMDKWAGLLGPISNHSFGGSFRTASNKEIKLSEHNIKKSKMF
FKDIEEQYPTSLACVEIVNTLALDNQKKLSKPQSINTVSAHLQSSVVVSDCKNSHITPQM
LFSKQDFNSNHNLTPSQKAEITELSTILEESGSQFEFTQFRKPSYILQKSTFEVPENQMT
ILKTTSEECRDADLHVIMNAPSIGQLDSSKQFEGTVEIKRKFAGLLKNDCNKSASGYLTD
ENEVGFRGFYSAHGAKLNVSTEALQKAVKLFSDIENISEETSAEVHPISLSSSKCHDSVV
SMFKIENHNDKTVSEKNKCQLILQNNIEMTTGTFVEEITENYKRNTENEDNKYTAASRNS
HNLEFDGSDSSKNDTVCIHKDETDLLFTDQHNICLKLSGQFMKEGNTQIKEDLSDLTFLE
VVKAQEACHGNTSNKEQLTATKTEQNIKDFETSDTFFQTASGKNISVAKESFNKIVNFFD
QKPEELHNFSLNSELHSDIRKNKMDILSYEETDIVKHKILKESVPVGTGNQLVTFQGQPE
RDEKIKEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQGTSEITSFSHQWAKTLKYRE
ACKDLELACETIEITTAPKCKEMQNSLNNDKNLVSIETVVPPKLLSDNLCRQTENLKTSK
SIFLKVKVHENVEKETAKSPATCYTNQSPYSVIENSALAFYTSCSRKTSVSQTSLREAKK
WLREGIFDGQPERINTADYVGNYLYENNSNSTIAENDKNHLSEKQDTYLSNSSMSNSYSY
HSDEVYNDSGYLSKNKLDSGIEPVLKNVEDQKNTSFSKVISNVKDANAYPQTVNEDICVE
ELVTSSSPCKNKNAAIKLSISNSNNFEVGPPAFRIASDETIKKVKDMFTDSFSKVIKENN
ENKSKICQTKIMAGCYEALDDSEDILHNSLDNDECSTHSHKVFADIQSEEILQHNQNMSG
LEKVSKISPCDVSLETSDICKCSIGKLHKSVSSTNTCGIFSTASGKSVQVSDASLQNARQ
VFSEIEDSTKQVFSKVLFKSNEHSDQLTREENTAIRTPEHLISQKGFSYNVVNSSAFSGF
STASGKQVSILESSLHKVKGVLEEFDLIRTEHSLHYSPTSRQNVSKILPRVDKRNPEHCV
NSEMEKTCSKEFKLSNNLNVEGGSSENNHSIKVSPYLSQFQQDKQQLVLGTKVSLVENIH
VLGKEQASPENVKMEIGKTEAFSDVPVKTNIEVCSTYSKDSENYFETEAVEIAKAFMEDD
ELTDSELPSHATHSLFTCPENEEMVLSNSRTGKRRGEPLILVGEPSIKRNLLNEFDRIIE
NQEKSLKASKSTPDGTIKDRRLFMHHVSLEPITCVPFRTTKEHQEIQNPNFTAPGQEFLS
ESHLYEHLTLEKSSSNLAVSGHPFYQVSATRNEKMRHLITTGRPTKVFVPPFKTKSHFHR
VEQCVRNINLEENRQKQNIDGHGSDDSKNKINDNEIHQFNKNLITSLQNARDIQDMRIKK
KQRQRVFPQPGSLYLAKTSTLPRISLKAAVGGQVPSACSHKQLYTYGVSKHCIKINSKNA
ESFQFHTEDYFGKESLWTGKGIQLADGGWLIPSSDGKAGKEEFYRALCDTPGVDPKLISR
IWVYNHYRWIIWKLAAMECAFPKEFANRCLSPERVLLQLKYRYDMEIDRSRRSAIKKIME
RDDTAAKTLVLCVSDIISLSANISETSSNKTSSADTQKVAIIELTDGWYAVKAQLDPPLL
AVLKNGRLTVGQKIILHGAELVGSPDACTPLEAPESLMLKVKQLKFLCSFWEVQRSFLSL
NNAFPIKKSLFYSGLENYILVLFKLLRTSSLQWLSFSCFLLIGFIYQKEQQQLGLSFLLI
LFLAASAQYSRVHDIYINHEENTTKPYLPSRALTRQQVRALQDGAELYEAVKNAADPANL
EGYFSEEQLRALNNHRQMLNDKKQAQIQLEVRKAMESAEQKEKGLSRDVTTVWKLRIVSY
SKKEKDSVILSIWRPSSDLYSLLTEGKRYRIYHLATSKSKSKSERANIQLAATKKTQYQQ
LPVSDEILFQVYQPREPLHFSKFLDPDFQPSCSEVDLIGFVISVVKKTGLAPFVYLSDEC
YNLLAIKFWIDLNEDIIKPHMLIAASNLQWRPESKSGLPTLFAGDFSVFSASPKEGHFQE
TFNKMKNTVENIDILCNEAENKLMHILHANDPKWSTPTKDCTSGPYTAQIIPGTGNKLLM
SSPNCEIYYQSPLSLCMAKRKSVSTPVSAQMTSKSCKGEKEIDDQKNCKKRRALDFLSRL
PLPPPVSPICTFVSPAAQKAFQPPRSCGTKYETPIKKKELNSPQMTPFKKFNEISLLESN
SIADEELALINTQALLSGSTGEKQFISVSESTR
Download sequence
Identical sequences ENSGGOP00000015446 ENSGGOP00000027226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]