SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015531 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015531
Domain Number 1 Region: 103-134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000471
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 41-89
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000432
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 3 Region: 72-119,505-540
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000152
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015531   Gene: ENSGGOG00000015918   Transcript: ENSGGOT00000015976
Sequence length 559
Comment pep:known_by_projection chromosome:gorGor3.1:17:54307424:54387892:1 gene:ENSGGOG00000015918 transcript:ENSGGOT00000015976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSACRSFAVAICILEISILTAQYKTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQ
MFRSRSIEVFGQFNGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCN
GDNDCGDFSDEDDCESEPRPPCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGL
CNRDRDGNTLTYYRRPWNVASLVYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAIS
LKFTPTEANKAEQCCEETASSISLHGKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVKGE
IHLGRFVMRNRDVVLTTTFVDDIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGIYELIY
VLDKASMNQKGVELKDIKRCLGYHLDVSLDFSEISVGAEFNKDDCVKRGEGRAVNITSKN
LIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLV
PVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACE
ISKQKISEGLPALEFPNEK
Download sequence
Identical sequences G3RIM1
ENSGGOP00000015531 XP_004058983.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]