SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015586 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015586
Domain Number 1 Region: 122-507
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.05e-148
Family Myotubularin-like phosphatases 0.0000000188
Further Details:      
 
Domain Number 2 Region: 7-114
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000148
Family GRAM domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015586   Gene: ENSGGOG00000015976   Transcript: ENSGGOT00000016034
Sequence length 713
Comment pep:known_by_projection chromosome:gorGor3.1:X:61509131:61636115:-1 gene:ENSGGOG00000015976 transcript:ENSGGOT00000016034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHITVPKVENVKLVDRYVSKKPANGILYLTATHLIYVEASGAARKETWIALHHIATVEK
LPITSLGCPLTLRCKNFRVAHFVLDSDLVCHEVYISLLKLSQPALPEDLYAFSYNPKSSK
EMRESGWKLIDPISDFGRMGIPNRNWTITDANRNYEICSTYPPEIVVPKSVTLGTVVGSS
KFRSKERVPVLSYLYKENNAAICRCSQPLSGFYTRCVDDELLLEAISQTNPGSQFMYVVD
TRPKLNAMANRAAGKGYENEDNYANIRFRFMGIENIHVMRSSLQKLLEVCELKTPTMSEF
LSGLESSGWLRHIKAIMDAGIFITKAVKVEKASVLVHCSDGWDRTAQVCSVASILLDPFY
RTFKGLMKMKILIEKEWISMGHKFSQRCGHLDRDSKEVSPIFTQFLDCIWQLMEQFPCAF
EFNENFLLEIHDHVFSCQFGNFLGNCQKDREDLRVYEKTHSVWPFLVQRKPDFRNPLYKG
FTMYGVLNPSTVPYNIQFWCGMYNRFDKGLQPKQSMLESLLEIKKQRAMLETDVHELEKK
LKVRDEPPEEICTCSQLGNILSQHLGSPLTNPLGFMGIDGDLNTLMENGTLSREGGLRAQ
MDQVKSQCADLHHNCCEIVGSLRAINISGDVGISGGTGISEAMGISGDMSTFEATGFSED
LGICGAVDISEATGISGNLGISEARGFSGDMGILGDTGISKASTKEADYSKHQ
Download sequence
Identical sequences ENSGGOP00000015586 ENSGGOP00000015586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]