SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015653 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015653
Domain Number 1 Region: 1219-1395
Classification Level Classification E-value
Superfamily AbfB domain 9.81e-22
Family AbfB domain 0.01
Further Details:      
 
Domain Number 2 Region: 883-947
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000294
Family ATI-like 0.03
Further Details:      
 
Domain Number 3 Region: 776-846
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000036
Family BSTI 0.029
Further Details:      
 
Domain Number 4 Region: 2371-2434
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000164
Family BSTI 0.02
Further Details:      
 
Domain Number 5 Region: 424-474
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000491
Family BSTI 0.047
Further Details:      
 
Domain Number 6 Region: 946-986
Classification Level Classification E-value
Superfamily FnI-like domain 0.000068
Family VWC domain 0.065
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015653
Domain Number - Region: 484-511
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00102
Family PMP inhibitors 0.0021
Further Details:      
 
Domain Number - Region: 1411-1464
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00118
Family BSTI 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015653   Gene: ENSGGOG00000016024   Transcript: ENSGGOT00000016102
Sequence length 2925
Comment pep:known_by_projection chromosome:gorGor3.1:11:17765856:17868502:1 gene:ENSGGOG00000016024 transcript:ENSGGOT00000016102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVLASALCWLLCVWLPWGEQAAESLWVQRLGERVVDSGRSGARGTRNVKGMRNGPAQTR
VSSSSSHQEVTLAMGDTATVVGGQQAEAPDSVAMSSWERRLHRAKCAPSYLFSCFNGGEC
VYPAFCDCRRFNATGPRCQMVYNAGPERDSICRAWGQHHVETFDGLYYYLSGKGSYTLVG
RREPEGQSFSIQVHNDPQCGSSPYTCSRAVSLFFVGEQEIHLAKEVTHGGVRVQLPHVMG
SVRLQPLAGYVIVRHQSAFTLAWDGASAVYIKMSPELLGWTHGLCGNNNADPKDDLVTSS
GKLTDDVVEFVHSWQEQAPNQPPGPTTSSLPRPPCLQQNPGTMQGVYEQCEALLRPPFDA
CHAYVSPLPFTASCTSDLCQSMGDVATWCRALAEYARACAQAGRPLQGWRTQIRQCTVHC
KEKAFTYNECIACCPASCQPRASCVDSEIACVDGCYCPNGLIFEDGGCVAPAECPCEFHG
TLYPPGSVVKEDCNACTCSAGRWECSTAVCPAECSVTGDIHFTTFDGRRYTFPATCQYIL
AKSRSSGTFTVTLQNAPCGLNQDGACVQSVSVILHQDPRRQVTLTQAGDVLLFDQYKIIP
PYTDDAFEIRRLSSVFLRVRTNVGVRVLYDREGLRLYLQVDQRWVEDTVGLCGTFNGNTQ
DDFLSPVGVPESTPQLFGNSWKTLSACSPLVPGSPLDPCDVHLQAASYSVQACSVLTGEL
FAPCSAFLSPVPYFEQCRRDACRCGQPCLCATLAHYAHLCRRHGLPVDFRARLPACALSC
EASKEYSPCVAPCGRTCQDLASPEACGVDGGDDLSRDECVEGCACPPDTYLDTQADLCVP
RNQCSCHFQGVDYPPGDSDIPSLGHCHCKDGVMSCDSRAPAAACPAGQVFVNCSDLHTDL
ELSRERTCEQQLLNLSVSARGPCLSGCACPQGLLRHGDACFLPEECPCTWKGKEYFPGDQ
VMSPCHTCVCQRGSFQCTLHPCASTCTAYGDRHYRTFDGLPFDFVGACKVHLVKSTSDVS
FSVIVENVNCYSSGMICRKFISINVGNSLIVFDDDSGNPSPESFLDDKQEVHTWRVGFFT
LVHFPREHITLLWDQRTTVHVQAGPQWQGQLAGLCGNFDLKTINEMRTPENLELTNPQEF
GSSWAAVECPDTLDPRDMCVLNPLREPFAKKECSILLSEVFEICHPVVDVTWFYSNCLTD
TCGCSRGGDCECFCASVSAYAHQCCQHGVAVDWRTPRLCPYDCDFFNKVLGKGPYQLSSL
AAGGALVGMKAVGDDIVLVRTEDVAPADIVSFLLTAALYKAKAHDPDVVSLEAADRPNFF
LHVTANGSLELAKWQGRDTFQQHASFLLHRGTRQAGLVALESLAKPSSFLYASGPVLALR
LYEHTEVFRRGTLFRLLDAKPSGAAYPICEWRYDACASPCFQTCRDPRAASCRDVPRVEG
CVPVCPTPRVLDEVTQRCVYLEDCVEPAVWVPTEALGNETLPPSQGLPTPSDEEPQLSQE
SPRTPTHRPALTTAAPLTTALNPPMTATEEPVVSPGPTQTTLQQPLELIASQLPAGPTEA
PASKGVTASLLAIPHTPESSSLPVALQTPTPGMVSGAMKTTRVTVIFAGSPNITVSSRSP
PAPRFPLMTKAVTVRGHGSLPVTTTPLQPSLTASPSSRPAASPGAVSRSPTSSGSHKAVL
TPAVTKVISRTGVPQPTQAQSASSPSTPLTVARTAAEQVPVSPLATRSLEIVLSTEKGEA
GHSQPMGSPASPQPHPLPTAPPRPAQHTTMATRSPALPPETPAATSLSTATHGLAATPFM
SLESTRPSQLLSGLPPDTSLPLAKVGTSAPVATPGPKASVITTPLQPQATTLPAQTLSPV
LPFTPAAMTQAHPPAHIAPPAAGTDPGLLLGATLPTSGVLPVAEGTASVVSVVPRKSTTG
KVAILSKQVSLPTSMYGSAEGGPTELMPATSHPLMPLVAEPEGAQAGTALPVPTSYPLSR
VSARTAPQDSMLVLLPQLAEAHGTSAGPHLAAELVDEATTEPSGRSAPALSIVEGLAEAL
ATTTEANTSTTCVPIAEQDCVRHICLEGQLIRVNQSQHCPQGAAPPRCGILGLAVRVGGD
RCCPLWECACRCSIFPDLSFVTFDGSHVALFKEAIYILSHSPDEMVTVHALDCKSANLGH
LNWPPFCLVMLNMTHLAHQVTIDRFNRKVTVDSQPVWPPVSRYGFRIEDTGHMYMILTPS
DIRIQWLHSSGLMIVEASKASKAQGHGLCGICDGDAANDLTLKDGSVVGGAEDPAPFLDS
WQVPSSLTSVGQTRFRPDSCATTDCSPCLRMVSNRTFSACHRFVPPESFCELWIRDTKYV
QQPCVALTVYVAMCHKFHVCIEWRRSDYCPFLCSSDSTYQACVTACEPPKTCQDGILGPL
DPEHCQVLGEGCICSEGTILHRRHSALCIPEAKCACTDSMGLPRALGETWNSSLSGCCQH
QCQAPDTIVPVDLGCPSPRPESCLRFGEVALLLPTKDPCCLGTVCVCNQTLCEGLAPTCR
PGHRLLTHFQEDSCCPSYSCECDPDLCEAELVPSCRQDQILIVGRLGDSCCTSYFCACGD
CPDSIPECQEGEALTVHRNTTELCCPLYQCVCENFRCPQVQCGLGTALVEVWSPDRCCPY
KSCGESVVRTASPLPTQWEKSQLDEEFMHSVENVCGCAKYECVKAPVCLSRELGVMQPGQ
TVVELSADGVCHTSRCTTVLDPLTSFYQINTTSVLCDIHCEANQEYEHPRDLAACCGSCR
NVSCLFTFPNGTTSLFLPGTSWIADCARHHCSSTPLGAVLVRSPISCPPLNETECAKVGG
SVVPSLEGCCRTCKEDGRSCKKVTIRMTIRKNECRSSTPVNLVSCDGRCPSASIYNYNIN
SYARFCKCCREVGLQRRSVQLFCATNATWVPYTVQEPTDCACQWS
Download sequence
Identical sequences ENSGGOP00000015653 ENSGGOP00000015653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]