SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015684 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015684
Domain Number 1 Region: 1647-1882
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.95e-78
Family Eukaryotic proteases 0.00000002
Further Details:      
 
Domain Number 2 Region: 1448-1550
Classification Level Classification E-value
Superfamily Kringle-like 1.4e-38
Family Kringle modules 0.00000603
Further Details:      
 
Domain Number 3 Region: 910-1011
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-38
Family Kringle modules 0.00000571
Further Details:      
 
Domain Number 4 Region: 1131-1235
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-38
Family Kringle modules 0.000002
Further Details:      
 
Domain Number 5 Region: 683-786
Classification Level Classification E-value
Superfamily Kringle-like 7.25e-38
Family Kringle modules 0.00000798
Further Details:      
 
Domain Number 6 Region: 1246-1349
Classification Level Classification E-value
Superfamily Kringle-like 1.04e-37
Family Kringle modules 0.0000034
Further Details:      
 
Domain Number 7 Region: 19-120
Classification Level Classification E-value
Superfamily Kringle-like 1.74e-37
Family Kringle modules 0.0000138
Further Details:      
 
Domain Number 8 Region: 130-234
Classification Level Classification E-value
Superfamily Kringle-like 1.84e-37
Family Kringle modules 0.00000918
Further Details:      
 
Domain Number 9 Region: 1026-1126
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-37
Family Kringle modules 0.00000119
Further Details:      
 
Domain Number 10 Region: 244-347
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-37
Family Kringle modules 0.00000904
Further Details:      
 
Domain Number 11 Region: 797-900
Classification Level Classification E-value
Superfamily Kringle-like 1.79e-36
Family Kringle modules 0.0000175
Further Details:      
 
Domain Number 12 Region: 464-565
Classification Level Classification E-value
Superfamily Kringle-like 7.49e-36
Family Kringle modules 0.00000977
Further Details:      
 
Domain Number 13 Region: 1545-1645
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-33
Family Kringle modules 0.0000123
Further Details:      
 
Domain Number 14 Region: 576-672
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-31
Family Kringle modules 0.0000156
Further Details:      
 
Domain Number 15 Region: 1360-1437
Classification Level Classification E-value
Superfamily Kringle-like 1.47e-20
Family Kringle modules 0.0000483
Further Details:      
 
Domain Number 16 Region: 358-412
Classification Level Classification E-value
Superfamily Kringle-like 1.01e-16
Family Kringle modules 0.0000843
Further Details:      
 
Domain Number 17 Region: 414-464
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-16
Family Kringle modules 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015684   Gene: ENSGGOG00000016065   Transcript: ENSGGOT00000016134
Sequence length 1883
Comment pep:known_by_projection chromosome:gorGor3.1:6:161733744:161902705:-1 gene:ENSGGOG00000016065 transcript:ENSGGOT00000016134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHKEVVLLLLLFLKSAAPEQSHVVQDCYHGDGQSYRGTYSTTVTGRTCQAWSSMTPHQH
NKTTENYPNAGLIMNYCRNPDPVAAPYCYTTDPSVRWEYCNLTQCSDAEGTAVAPPTVTP
VPSLEDLSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEY
YPNAGLIMNYCRNPDPVAAPYCYTTDPSVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLED
LSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGL
IMNYCRNPDPVAAPYCYTRDPSVRWEYCNLTQCSDAEGTAVAPPTVTPVRSLEAPSEQAP
TEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNPTEQRPGVQ
ECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNPTEQRPGVQECYHGNGQ
SYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDPVAAPYCYTRDPS
VRWEYCNLTQCSDAEGTAVAPPTVTPVRSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTY
STTVTGRTCQAWSSMTPHSHSRTPEYYPNCRNPRSVAAPYCYTRDPSVRWEYCNLTQCSD
AEGTAVAPPTVTPVRSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWS
SMTPHSHSRTPEYYPNAGLIMNYCRNPDPVAAPYCYTMDPSVRWEYCNLTQCSEAEGTAV
APPTVTPVRSLEAPSEQAPTEQRPGVQECYHGNGHSYRGTYFITVTERTCQAWSSMTPHS
HSRTPAYYPNAGLIKNYCRNPDPVAAPWCYTTDPSVRWEYCNLTRCSDAEWTAFVPPNVI
PAPSLEAFFEQAPTEETPGVQDCYYHYGQSYRGTYSTTVTGRTCQAWSSMTPHQHSRTPE
NYPNAGLTRNYCRNPDAEIRPWCYTRDPSVRWEYCNLTQCLVTESSVLATLTVVPDPSTE
ASSEEAPTEQSPGAQDCYHGDGQSYRGSFSTTVTGRTCQSWSSMTPHWHQRTTEYYPNGG
LTRNYCRNPDAEISPWCYTMDPNVRWEYCNLTQCPVTESSVLATSTAVSEQAPTEQSPRV
QDCYHGDGQSYRGSFSTTVTGRTCQPWSSMTPHWHQRTTEYYPNGGLTRNYCRNPDAEIR
PWCYTMDPSVRWEYCNLTQCPVMESTVLTTPTVVPVPSTEVPSEEAPTENSPGVQDCYRG
DGQSYRGTLSTTITGRTCQSWSSMTPHWHRRIPLYYPNAGLTRNHCRNPDAEIRPWCYTM
DPSVRWEYCNLTQCPVTESSVLTTPTVAPVPSTEAPSEQAPPEKSPVVQDCYHGDGRSYR
GISSTTVTGRTCQSWSSMIPHWHQRTPENYPNRWEYCNLTQCSETESGVLETPTVVPVPS
MEAHSEATPTEQTPVVQQCYHGNGQSYRGTFSTTVTGRTCQSWSSMTPHRHQRTPENYPN
DGLTMNYCRNPDANTGPWCFTTDPSVRWEYCNLTRCSDTEGTVVTPPTVIRVPSLEAPSE
QDCMFGNGKGYRGKKATTVTGMPCQEWAAQEPHRHSNFIPGTNKWAGLEKNYCRNPDGDI
NGPWCYTMNPRKLFDYCDIPLCASSSFDCGKPQVEPKKCPGSIVGGCVAHPHSWPWQVSL
RTRFGKHFCGGTLISPEWVLTAAHCLKKSSRPSSYKVILGAHQEVNLESHVQEIEVSRLF
LEPTQADIALLKLSRLAVITDKVMPACLPSPDYMVTARTECYITGWGETQGTFGTGLLKE
AQLLVIENEVCNHYKYICAEHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARP
NKPGVYARVSRFVTWIEGMMRNN
Download sequence
Identical sequences ENSGGOP00000015684 ENSGGOP00000015684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]