SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015780 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015780
Domain Number 1 Region: 81-130
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000000353
Family Elafin-like 0.00068
Further Details:      
 
Domain Number 2 Region: 29-76
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000000955
Family Elafin-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015780   Gene: ENSGGOG00000016177   Transcript: ENSGGOT00000016231
Sequence length 132
Comment pep:novel chromosome:gorGor3.1:20:43050898:43053211:-1 gene:ENSGGOG00000016177 transcript:ENSGGOT00000016231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSNSLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGK
KRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVAYGQCLMLNPPNFCEMDGQCKRNLKCCMG
MCGKSCVSPVKA
Download sequence
Identical sequences A4K2R9
ENSGGOP00000015780 ENSGGOP00000015780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]