SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015799 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015799
Domain Number 1 Region: 168-462
Classification Level Classification E-value
Superfamily L domain-like 8.5e-55
Family Ngr ectodomain-like 0.065
Further Details:      
 
Domain Number 2 Region: 47-232
Classification Level Classification E-value
Superfamily RNI-like 3.92e-26
Family 28-residue LRR 0.043
Further Details:      
 
Domain Number 3 Region: 603-701
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 687-788
Classification Level Classification E-value
Superfamily Immunoglobulin 7.3e-21
Family I set domains 0.014
Further Details:      
 
Domain Number 5 Region: 498-608
Classification Level Classification E-value
Superfamily Immunoglobulin 3.09e-16
Family I set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015799   Gene: ENSGGOG00000016188   Transcript: ENSGGOT00000016251
Sequence length 1119
Comment pep:known_by_projection chromosome:gorGor3.1:12:57096261:57144609:-1 gene:ENSGGOG00000016188 transcript:ENSGGOT00000016251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPSLRARAAGLGLLLCAVLGRAGRSDSAGRGELGQPSGVAAERPCPTTCRCLGDLLDC
SRKRLARLPEPLPSWVARLDLSHNRLSFIKASSMSHLQSLREVKLNNNELETIPNLGPVS
ANITLLSLAGNRIVEILPEHLKEFQSLETLDLSSNNISELQTAFPALQLKYLYLNSNRVT
SMEPGYFDNLANTLLVLKLNRNRISAIPPKMFKLPQLQHLELNRNKIKNVDGLTFQGLGA
LKSLKMQRNGVTKLMDGAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAIN
RISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGLSS
LKTLDLKNNEISWTIEDMNGAFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLSDN
AIMSLQGNAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQSFVNASCAHPQLLKG
RSIFAVSPDGFVCDDFPKPQITVQPETQSAIKGSNLSFICSAASSSDSPMTFAWKKDNEL
LHDAEMENYAHLRAQGGEVMEYTTILRLREVEFASEGKYQCVISNHFGSSYSVKAKLTVN
MLPSFTKTPMDLTIRAGAMARLECAAVGHPAPQIAWQKDGGTDFPAARERRMHVMPEDDV
FFIVDVKIEDIGVYSCTAQNSAGSISANATLTVLETPSFLRPLLDRTVTKGETAVLQCIA
GGSPPPKLNWTKDDSPLVVTERHFFAAGNQLLIIVDSDVSDAGKYTCEMSNTLGTERGNV
RLSVIPTPTCDSPQMTAPSLDDDGWATVGVVIIAVVCCVVGTSLVWVVIIYHTRRRNEDC
SITNTDETNLPADIPSYLSSQGTLADRQDGYVSSESGSHHQFVTSSGAGFFLPQHDSSGT
CHIDNSSEADVEAATDLFLCPFLGSTGPMYLKGNVYGSDPFETYHTGCGPDPRTVLMDHY
EPSYIKKKECYPCSHPSEESCERSFSNIAWPSHVRKLLNTSYSQNEGPGMKNLCLNKSSL
DFSANPEPASVALSNSFMGTFGKALRRPHLDAYSSFGQPSDCQPRAFYLKAHSSPDLDSG
SEEDGKERTDFQEENHVCTFKQTLENYRTPNFQSYNLDT
Download sequence
Identical sequences G3RJB5
XP_004053523.1.27298 ENSGGOP00000015799 ENSGGOP00000015799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]