SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015851 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015851
Domain Number 1 Region: 157-195,229-266
Classification Level Classification E-value
Superfamily Immunoglobulin 8.8e-17
Family I set domains 0.03
Further Details:      
 
Domain Number 2 Region: 31-124
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000926
Family Growth factor receptor domain 0.0015
Further Details:      
 
Domain Number 3 Region: 111-157
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000134
Family Ovomucoid domain III-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015851   Gene: ENSGGOG00000016249   Transcript: ENSGGOT00000016303
Sequence length 282
Comment pep:known_by_projection chromosome:gorGor3.1:4:65290828:65373347:-1 gene:ENSGGOG00000016249 transcript:ENSGGOT00000016303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPSLRALLLGAAGLLLLLLPLSSSSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCC
PMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVC
GSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLS
CEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSK
EDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEDAEL
Download sequence
Identical sequences ENSGGOP00000015851 ENSGGOP00000015851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]