SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015866 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015866
Domain Number 1 Region: 1340-1651
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.21e-111
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000842
Further Details:      
 
Domain Number 2 Region: 1616-1904
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.33e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000931
Further Details:      
 
Domain Number 3 Region: 322-516
Classification Level Classification E-value
Superfamily Fibronectin type III 3.36e-45
Family Fibronectin type III 0.00054
Further Details:      
 
Domain Number 4 Region: 514-711
Classification Level Classification E-value
Superfamily Fibronectin type III 2.15e-43
Family Fibronectin type III 0.0005
Further Details:      
 
Domain Number 5 Region: 823-1015
Classification Level Classification E-value
Superfamily Fibronectin type III 2.04e-36
Family Fibronectin type III 0.0007
Further Details:      
 
Domain Number 6 Region: 667-824
Classification Level Classification E-value
Superfamily Fibronectin type III 5.02e-30
Family Fibronectin type III 0.0008
Further Details:      
 
Domain Number 7 Region: 22-116
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-18
Family I set domains 0.0041
Further Details:      
 
Domain Number 8 Region: 126-217
Classification Level Classification E-value
Superfamily Immunoglobulin 2.07e-16
Family I set domains 0.021
Further Details:      
 
Domain Number 9 Region: 234-328
Classification Level Classification E-value
Superfamily Immunoglobulin 2.79e-16
Family I set domains 0.016
Further Details:      
 
Domain Number 10 Region: 1023-1145,1205-1251
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000389
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015866   Gene: ENSGGOG00000016241   Transcript: ENSGGOT00000016318
Sequence length 1912
Comment pep:known_by_projection chromosome:gorGor3.1:9:8499408:8914038:-1 gene:ENSGGOG00000016241 transcript:ENSGGOT00000016318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHVARLLLLLLTFFLRTDAETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKK
GKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLREDQ
IPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRS
VHPGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRGFVPVRRVPPRFSI
PPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGRNVLELNDVRQSANY
TCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWDSGNPEPVSYYIIQHKP
KNSEEPYKEIDGVATTRYSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSA
PRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIG
NLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPR
SDTIANYELVYKDGEHGEEQRITIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEI
SARTMQSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQNGIITEYSIKYTAVDGEDDKPH
EILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSVLIRTNEDVPSGPPRKVEV
EAVNSTSVKVSWRSPVPNKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEFDDT
TEHDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTGAVPGKPRLVINHTQMNTAL
IQWHPPVDTFGPLQGYRLKFGRKDMEPLTTLEFSEKEDHFTATDIHKGASYIFRLSARNK
VGFGEEMVKEISIPEEVPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGIITKYTLLYRD
INIPLLPMEQLIVPADTTMTLTGLKPDTTYDVKVCAHTSKGPGPYSPSVQFRTLPVDQVF
AKNFHVKAVMKTSVLLSWEIPENYNSAMPFKILYDDGKMVEEVDGRATQKLIVNLKPEKS
YSFVLTNRGNSAGGLQHRVTAKTAPDVLRTKPAFIGKTNLDGMITVQLPEVPANENIKGY
YIIIVPLKKSRGKFIKPWESPDEMELDELLKEISRKRRSIRYGREVELKPYIAAHFDVLP
TEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPI
TDEEEGLIWVVGPVLAVVFIICIVIAILLYKRKRAESDSRKSSIPNSKEIPSHHPTDPVE
LRRLNFQTPGMASHPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVN
KPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFW
RMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFAL
YKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRT
GCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEV
PARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMP
YESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIV
VMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTV
RQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIV
LERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYLGSFDHYAT
Download sequence
Identical sequences ENSGGOP00000015866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]