SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015894 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015894
Domain Number 1 Region: 185-300
Classification Level Classification E-value
Superfamily POZ domain 3.45e-34
Family BTB/POZ domain 0.0089
Further Details:      
 
Domain Number 2 Region: 30-175
Classification Level Classification E-value
Superfamily TRAF domain-like 1.8e-19
Family MATH domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015894   Gene: ENSGGOG00000009295   Transcript: ENSGGOT00000016347
Sequence length 379
Comment pep:known_by_projection chromosome:gorGor3.1:5:34451081:34465002:1 gene:ENSGGOG00000009295 transcript:ENSGGOT00000016347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRVPSPPPPAEMSSGPVAESWCYTQQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSS
GANDKLKWCLLLNKKGDLFAYLDPASQCYILCILLLSVERDNIVARLEFFVLNLRQNKVN
TFVSLAPLPRFVVQGRNWGKKRFVGLSSYCPEMVLNKDKALICGEVSVVQDSVNISGQNT
MNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEE
SKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCS
NLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRS
LASAQCPFLGPPRKRLKQS
Download sequence
Identical sequences ENSGGOP00000009080 ENSGGOP00000015894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]