SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015927 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015927
Domain Number 1 Region: 28-517
Classification Level Classification E-value
Superfamily Sema domain 1.57e-178
Family Sema domain 0.0000000000798
Further Details:      
 
Domain Number 2 Region: 513-564
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000262
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 580-661
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000298
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015927   Gene: ENSGGOG00000016324   Transcript: ENSGGOT00000016381
Sequence length 751
Comment pep:known_by_projection chromosome:gorGor3.1:7:77843582:78021899:-1 gene:ENSGGOG00000016324 transcript:ENSGGOT00000016381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFRTICVLVGVFICSICVKGSSQPQARVYLTFDELQETKTSEYFSLSHHPLDYRILLMD
EDQDRIYVGSKDHILSLNINNISQEPLSVFWPASTIKVEECKMAGKDPTHGCGNFVRVIQ
TFNRTHLYVCGSGAFSPVCTYLNRGRRSEDQVFMIDSKCESGKGRCSFNPNVNTVSVMIN
EELFSGMYIDFMGTDAAIFRSLTKRNAVRTDQHNSKWLSEPMFVDAHVIPDGTDPNDAKV
YFFFKEKLTDNNRSTKQIHSMIARICPNDTGGLRSLVNKWTTFLKARLVCSVTDEDGPET
HFDELEDVFLLETDNPRTTLVYGIFTTSSSVFKGSAVCVYHLSDIQTVFNGPFAHKEGPN
HQLISYQGRIPYPRPGTCPGGAFTPNMRTTKEFPDDVVTFIRNHPLMYNSIYPIHKRPLV
VRIGTDYKYTKIAVDRVNAADGRYHVLFLGTDRGTVQKVVVLPTNNSVSGELILEELEVF
KNHAPITTMKISSKKQQLYVSSNEGVSQVSLHRCHIYGTACADCCLARDPYCAWDGHSCS
RFYPTGKRRSRRQDVRHGNPLTQCRGFNLKAYRNAAEIVQYGVKNNTTFLECAPKSPQAS
IKWLLQKDKDRRKEVKLNERIIATSQGLLIRSVQGSDQGLYHCIATENSFKQTIAKINFK
VLDSEMVAVVTDKWSPWTWASSVRALPFHPKDIMGAFSHSEMQMINQYCKDTRQQHQQGD
ESQKMRGDYGKLKALINSRKSRNRRNQLPES
Download sequence
Identical sequences G3RJN2
ENSGGOP00000015927 XP_004045707.1.27298 ENSGGOP00000015927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]