SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016063 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016063
Domain Number 1 Region: 21-118
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-26
Family V set domains (antibody variable domain-like) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016063   Gene: ENSGGOG00000016468   Transcript: ENSGGOT00000016520
Sequence length 144
Comment pep:known_by_projection chromosome:gorGor3.1:22:6049507:6050230:1 gene:ENSGGOG00000016468 transcript:ENSGGOT00000016520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWAPVLLMLFVYCTGCGPQPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQR
PGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGAR
SSEKDREREWEEEMEPTAAGTRVP
Download sequence
Identical sequences G3RK08
XP_004063159.1.27298 ENSGGOP00000016063 ENSGGOP00000028306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]