SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016080 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016080
Domain Number 1 Region: 4-114
Classification Level Classification E-value
Superfamily POZ domain 7.26e-25
Family BTB/POZ domain 0.0022
Further Details:      
 
Domain Number 2 Region: 575-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000144
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 3 Region: 633-684
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000123
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016080
Domain Number - Region: 671-710
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00251
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number - Region: 193-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0161
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Domain Number - Region: 533-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0219
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016080   Gene: ENSGGOG00000016483   Transcript: ENSGGOT00000016538
Sequence length 713
Comment pep:known_by_projection chromosome:gorGor3.1:14:45501354:45519876:1 gene:ENSGGOG00000016483 transcript:ENSGGOT00000016538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKPSHSSYVLQQLNNQREWGFLCDCCIAIDDIYFQAHKAVLAACSSYFRMFFMNHQHST
AQLNLSNMKISAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQLYNVPDCLEDIQDAD
CSSSKCSSSASSKQNSKMIFGVRMYEDTVARNGNEANRWCAEPSSTVNTPHNREADEESL
QLGNFPEPLFDVCKKSSVSKLSTPKERVSRRFGRSFTCDSCGFGFSCEKLLDEHVLTCTN
RHLYQNTRSYHRIVDIRDGKDSNIKAEFGEKDSSKTFSAQTDKYRGDTSQAADDSASTTG
SRKSSTVESEIASEEKSRAAERKRIIIKMEPEDIPTDELKDFNIIKVTDKDCNESTDNDE
LEDEPEEPFYRYYVEEDVSIKKSGRKTLKPRMSVSADERGGLENMRPPNNSSPVQEDTEN
ASCELCGLTITEEDLSSHYLAKHIENICACGKCGQILVKGRQLQEHAQRCGEPQDLTMNG
LGNTEEKMDLEENPDEQSEIRDMFVEMLDDFRDNHYQINSIQKKQLFKHSACPFRCPNCG
QRFETENLVVEHMSSCLDQDMFKSAIMEENERDHRRKHFCNLCGKGFYQRCHLREHYTVH
TKEKQFVCQTCGKQFLRERQLRLHNDMHKGMARYVCSICDQGNFRKHDHVRHMISHLSAG
ETICQVCFQIFPNNEQLEQHMDVHLYTCGICGAKFNLRKDMRSHYNAKHLKRT
Download sequence
Identical sequences XP_018865097.1.27298 XP_018865098.1.27298 XP_018865099.1.27298 XP_018865100.1.27298 ENSGGOP00000016080 ENSGGOP00000016080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]