SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016123 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016123
Domain Number 1 Region: 7-118
Classification Level Classification E-value
Superfamily POZ domain 2.94e-25
Family BTB/POZ domain 0.00078
Further Details:      
 
Domain Number 2 Region: 772-812
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-23
Family Classic zinc finger, C2H2 0.00061
Further Details:      
 
Domain Number 3 Region: 706-747
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000179
Family Classic zinc finger, C2H2 0.00078
Further Details:      
 
Domain Number 4 Region: 909-959
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000816
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 749-771
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000163
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 6 Region: 543-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000226
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 7 Region: 668-698
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000205
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016123
Domain Number - Region: 1017-1065
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000424
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016123   Gene: ENSGGOG00000016529   Transcript: ENSGGOT00000016581
Sequence length 1066
Comment pep:known_by_projection chromosome:gorGor3.1:21:30615209:30631120:-1 gene:ENSGGOG00000016529 transcript:ENSGGOT00000016581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLLHYINPAHAISLLSALNEERLKGQLCDVLLIVGDQKFRAHKNVLAASSEYFQSLFT
NKENESQTVFQLDFCEPDAFDNVLNYIYSSSLFVEKSSLAAVQELGYSLGISFLTNIVSK
TPQAPFPTCPNRKKVFVEDDENSSQKRSVIVCQSRNEVQGKTVSQNQPDVSHTSRPSPSI
AVKANTNKPHVPKPIEPLHNLSLTEKSWPKDSSVVYAKSLEHSGSLDDPNRISLVKINAV
LPSKPLQDREAMDDKPGVSGQLPKGKALELALKRPRPPVLSVCSSSETPYLLKETNKGNG
QGEDRNLLYYSKLGLVIPSSGSGSGNQSIDRSGPLVKSLLRRSLSMDSQVPVYSPSIDLK
SSQGSSSVSSDAPGNVLCALSQKSSLKDGSEKTALDDRPQVLQPHRLRSFSASQSTDREG
ASPVTEVRIKTEPSSPLSDPSDIIRVTVGDAAATAAASSSSVTRDLSLKTEDDQKDMSRL
PAKRRFQADRRLPFKKLKVNEHGSPVSEDNFEEGSSPTLLDADFPDSDLNKDEFGELEGT
RPNKKFKCKHCLKIFRSTAGLHRHVNMYHNPEKPYACDICHKRFHTNFKVWTHCQTQHGI
VKNPSPASSSHAVLDEKFQRKLIDIVREREIKKALIIKLRRGKPGFQGQSSSQAQQVIKR
NLRSRAKGAYICTYCGKAYRFLSQFKQHIKMHPGEKPLGVNKVAKPKEHAPLASPVENKE
VYQCRLCNAKLSSLLEQGSHERLCRNAAVCPYCSLRFFSPELKQEHESKCEYKKLTCLEC
MRTFKSSFSIWRHQVEVHNQNNMAPTENFSLPVLDHNGDVTGSSRPQSQPEPNKVNHIVT
TKDDNVFSDSSEQVNFDSEDSSCLPEDLSLSKQLKIQVKEEPVEEAEEEAPEASTAPKEA
GPSKEASLWPCEKCGKMFTVHKQLERHQELLCSVKPFICHVCNKAFRTNFRLWSHFQSHM
SQASEESAHKESEVCPVPTNSPSPPPLPPPPPLPKIQPLEPDSPTGLSENPTPATEKLFV
PQESDTLFYHAPPLSAITFKRQFMCKLCHRTFKTAFSLWSHEQTHN
Download sequence
Identical sequences ENSGGOP00000016123 ENSGGOP00000016123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]