SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016194 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016194
Domain Number 1 Region: 602-713
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000392
Family BTB/POZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016194   Gene: ENSGGOG00000016599   Transcript: ENSGGOT00000016653
Sequence length 1759
Comment pep:known_by_projection chromosome:gorGor3.1:16:3781862:3807985:-1 gene:ENSGGOG00000016599 transcript:ENSGGOT00000016653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSVNEAQLGFYLGSLSHLSACPGIDPRSSEDQPERLKTGQMMDESDEDFKELCASFFQ
RVKKHGIKEVSGERKTQKATSNGTQIRSKLKRTKQTATKTKTLQGPAEKKPPSGSQAPRT
KKQGATKWQASEPALSVNGEGGVLASAPDPPVLWETAQNTQTGNQQEPSPNLSREKTRVY
GLGPPAPESDAAVALTLQQEFARVGASAHDDSLEEKGLFFCQICQKNLSAMNVTRREQHV
NRCLDEAEKTLRPSVPQIPECPICGKPFLTLKSRTSHLKQCAVKMEVGPQLLLQAVRLQT
AQPEGSSSPPVFSFSDHSRGLKRRGPTSKKEPRKRRKVDEAPSEDLLVAMALSRSEMEPG
AAVPALRLESAFSERIRPEAEKKSRKKKPPVSPPLLLVQDSKTTGRQIEDRVALLLSEEV
ELSSTPPLPASRILKEGWERAGQCPPPPERKQSFLWEGSALTGAWAVEDFYTARLVPPLV
PQRPAQGLMQEPVPPLVPPEHSELSERRSSALHGTPTAGCGSRGPSPSASQREHQALQDL
VDLAREGLSASPWPGSGGLAGSEGTAGLDVVPGGLPLTGFVVPSQDKHADRGGRTSLSLG
LLVADFGAMVNNPHLSDVQFQTDSGEVLYAHKFVLYARCPLLIQYVNNEGFSAVEDGVLT
QRVLLGDVSTEAARTFLHYLYTADTGLPPGLSSELSSLAHRFGVSELVHLCEQVPIATDS
EGKPWEEKEAENCESRAENFQELLRSMWADEEEEAETLLKSKDHEEDQENVNEAEMEEIY
EFAATQRKLLQEERAAGAGEDADWLEGGSPVSGQLLAGVQVQKQWDKVEEMEPLEPGRDE
AATTWEKVGQCALPPPQGQHSGARGAEAPEQEAPEEALGHSSCSSPSRDCRAERKEGSLP
HSDDSGDYEQLFLSTQGEISEPSQITSEPEEQSGAVRERGLEVSHRLAPWQASPPHPCRF
LLGPPQGGSPRGSHHTSGSSLSTPWSRGGTSQVGSPTLLSPAVPSKQKRDRSILTLSKEP
GHQKGKERQSVLECRNKGVLMFPEKSLSIDLTQSNPDHSSSRSQKSSSKLNKEDEVILLL
DSDEELELEQTKMKSISSDPLEERKALEISPRSCELFSIIDVDADQEPSQSPPRSEAVLQ
QEDEGALPENRGCLGSRGAPWLFCDRESSPSEASTTDTSWLVPATPLASRSRDCSSQTQI
SSLRSGLAVQAVTQHTPRASVGNREGKEAAQKFSVIRPQTPPPQTPSSCLTPVSLGTSDS
RRQGHRSPSRPHPGGHPHSSPLAPHPVSGDRAHFSRRFLKHSPPGPSFLNQTPAGEVVEV
GDSDDEQEVASHQANSSPPLDSDPPIPIDDCCWHMEPLSPIPIDHWNLERTGPLSTSSPS
RRMKEAADSRDCRSPGLLDTTPIRGNFTTQRKLQEKSSGAGSPGNSRPSFLNSALWDVWD
GEEQRPPETPPPAEMLSAGGAQKPDGLETPKGANRKKNLPPKVPITPMPQYSIMETPVLK
KELDRFGVRPLPKRQMVLKLKEIFQYTHQTLDSDSEDESQSLQPLLQAPRCQTLASQTHK
ASRAGVHAQQEATTGPGAHRPKGPAKTKGPRHQRKHHESITPPSRSPTKEAPPGLDDDAQ
IPASQESVATSVDGSDSSLSSQSSSSCEFGAAFESAGEEEGEGEVSASQAAVQAADTDEA
LRCYIRSKPALYQKVLLYQPFELRELQAELKQNGLRVSSRRLLDFLDTHCITFTTAATRR
EKLQGRRRQPRGKKKVERN
Download sequence
Identical sequences ENSGGOP00000016194 ENSGGOP00000028485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]