SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016212 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016212
Domain Number 1 Region: 602-808
Classification Level Classification E-value
Superfamily Fibronectin type III 4.3e-32
Family Fibronectin type III 0.00063
Further Details:      
 
Domain Number 2 Region: 808-990
Classification Level Classification E-value
Superfamily Fibronectin type III 4.65e-26
Family Fibronectin type III 0.00028
Further Details:      
 
Domain Number 3 Region: 240-334
Classification Level Classification E-value
Superfamily Immunoglobulin 4.04e-20
Family I set domains 0.00053
Further Details:      
 
Domain Number 4 Region: 412-509
Classification Level Classification E-value
Superfamily Immunoglobulin 1.09e-19
Family I set domains 0.0095
Further Details:      
 
Domain Number 5 Region: 504-608
Classification Level Classification E-value
Superfamily Immunoglobulin 2.55e-18
Family I set domains 0.017
Further Details:      
 
Domain Number 6 Region: 327-409
Classification Level Classification E-value
Superfamily Immunoglobulin 1.49e-17
Family I set domains 0.00029
Further Details:      
 
Domain Number 7 Region: 57-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000191
Family I set domains 0.004
Further Details:      
 
Domain Number 8 Region: 136-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000677
Family I set domains 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016212   Gene: ENSGGOG00000016609   Transcript: ENSGGOT00000016671
Sequence length 1018
Comment pep:known_by_projection chromosome:gorGor3.1:12:38595828:38760779:1 gene:ENSGGOG00000016609 transcript:ENSGGOT00000016671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMWLLVSHLVIISITTCLAEFTWYRRYGHGVSEEDKGFGPIFEEQPINTIYPEESLEGK
VSLNCRARASPFPVYKWRMNNGDVDLTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNNY
GMVRSTEATLSFGYLDPFPPEERPEVRVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVF
ITMDKRRFVSQTNGNLYIANVEASDKGNYSCFVSSPSITKSVFSKFIPLIPIPERTTKPY
PADIVVQFKDVYALMGQNVTLECFALGNPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNI
QLEDEGIYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYWPCVATGKPIP
TIRWLKNGYAYHKGELRLYDVTFENAGMYQCIAENTYGAIYANAELKILALAPTFEMNPM
KKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWLVNSSRILIWEDGSLEINNITRNDGG
IYTCFAENNRGKANSTGTLVITDPTRIILAPINADITVGENATMQCAASFDPALDLTFVW
SFNGYVIDFNKENIHYQRNFMLDSNGELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVV
RGPPGPPGGLRIEDIRATSAALTWSRGSDNHSPISKYTIQTKTILSDDWKDAKTDPPIIE
GNMEAARAVDLIPWMEYEFRVVATNTLGRGEPSIPSNRIKTDGAAPNVAPSDVGGGGGRN
RELTITWAPLSREYHYGNNFGYIVAFKPFDGEEWKKVTVTNPDTGRYVHKDETMSPSTAF
QVKVKAFNNKGDGPYSLVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWEHVLEKIVESY
QIRYWAAHDKEEAANRVQVTSQEYSARLENLLPDTQYFIEVGACNSAGCGPPSDMIEAFT
KKAPPSQPPRIISSVRSGSRYIITWDHVVALSNESTVTGYKVLYRPDGQHDGKLYSTHKH
SIEVPIPRDGEYVVEVRAHSDGGDGVVSQVKISGAPTLSPSLLGLLLPAFGILVYLEF
Download sequence
Identical sequences ENSGGOP00000016212 ENSGGOP00000016212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]