SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016223 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016223
Domain Number 1 Region: 29-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000223
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 70-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 110-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016223   Gene: ENSGGOG00000016627   Transcript: ENSGGOT00000016682
Sequence length 345
Comment pep:known_by_projection chromosome:gorGor3.1:11:36552092:36845872:1 gene:ENSGGOG00000016627 transcript:ENSGGOT00000016682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLGPLCLLLSSAAESQLLPGNNFTNECNIPGNFMCSNGRCIPGAWQCDGLPDCFDKSD
EKECPKAKSKCGPTFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARYHC
KNGLCIDKSFICDGQNNCQDNSDEESCESSQEPGSGQVFVTSENQLVYYPSITYAIIGSS
VIFVLVVALLALVLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCNVTYNVNNGIQ
YVASQAEQNASEVGSPPSYSEALLDQRPAWYDLPPPPYSSDTESLNQADLPPYRSRSGSA
NSASSQAASSLVSVEDTSHSPGQPGPQEGTAEPRDSEPSQGTEEV
Download sequence
Identical sequences G3RKF8
ENSGGOP00000016223 XP_018892491.1.27298 ENSGGOP00000016223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]