SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016251 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016251
Domain Number 1 Region: 369-541
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.75e-28
Family Toll/Interleukin receptor TIR domain 0.00081
Further Details:      
 
Domain Number 2 Region: 25-105
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000317
Family I set domains 0.028
Further Details:      
 
Domain Number 3 Region: 223-318
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000533
Family I set domains 0.024
Further Details:      
 
Domain Number 4 Region: 127-197
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000151
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016251   Gene: ENSGGOG00000016653   Transcript: ENSGGOT00000016710
Sequence length 556
Comment pep:known_by_projection chromosome:gorGor3.1:2a:99844024:99858684:1 gene:ENSGGOG00000016653 transcript:ENSGGOT00000016710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFWILAILTILMYSTAAKFIKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQ
ERNRVFASGQLLKFLPAEVADSGIYICIVRSPTFNRTGYANVTIYKKQSDCYVPDYLMYS
TVSGSEKTSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYT
CKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAHNEIKEVEIGKNANLTCSACFG
KGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQ
YDCLALNLHGLRRHTVRLSRKNPIDHHSTYCIIAVCSVFLMLINVLVIILKMFWIEATLL
WRDIAKPYKTRNDGKLYDAYVIYPRNYKSSTDGASRVEHFVHQILPDVLENKCGYTLCIY
GRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILI
EMEAPSELDMLQAEALQDSLRHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSK
IPRKASSLTPLAAQKQ
Download sequence
Identical sequences G3RKI3
ENSGGOP00000016251 XP_004031574.2.27298 ENSGGOP00000016251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]