SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016391 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016391
Domain Number 1 Region: 155-250
Classification Level Classification E-value
Superfamily S13-like H2TH domain 6.41e-22
Family Middle domain of MutM-like DNA repair proteins 0.016
Further Details:      
 
Domain Number 2 Region: 62-151
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.000000419
Family N-terminal domain of MutM-like DNA repair proteins 0.01
Further Details:      
 
Domain Number 3 Region: 318-345
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000353
Family Ran binding protein zinc finger-like 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016391
Domain Number - Region: 246-282
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0371
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016391   Gene: ENSGGOG00000016799   Transcript: ENSGGOT00000016855
Sequence length 606
Comment pep:known_by_projection chromosome:gorGor3.1:4:187967546:188038385:1 gene:ENSGGOG00000016799 transcript:ENSGGOT00000016855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEGPGCTLNGEKIRARVLPGQAVTGVRGSALRSLQGRALRLAASTAVVSPQAAALNNND
SSQNVLSLFNGYVYSGVETLGKELFMYFGPKALRIHFGMKGFIMINPLEYKYKNGASPVL
EVQLTKDLICFFDSSVELRNSMESQQRIRMMKELDVCSPEFSFLRAESEVKKQKGRMLGD
VLMDQNVLPGVGNIIKNEALFDSGLHPAVKVCQLTDEQIHHLVKMIRDFSILFYRCRKAG
LALSKHYKVYKRPNCGQCHCRITVCRFGDNNRMTYFCPHCQKENPQHVDICKLPTRNTII
SWTSSRVDHVMDSVARKSEEHWTCVVCTLINKPSSKACGACLTSRPIDSVLKNEENSTVF
SHLMKYPCNTFGKPHTEVKINRKTAFGTTTLVLTDFSNKSSTLERKTKQNQILDEEFQNS
PPTNVCLNDIQHPSKKTTNDITQLSSKVNISPTISSESKLFSPAHKKLKTAHYSSPELKS
CNPGYSNSELQINMTDGPRTLNPDSPRCSKHNRLCILRVVRKDGENKGRQFYACPLPREA
QCGFFEWADLSFPFCNHGKRSIMKTVLKIGPNNGKNFFVCPLGKEKQCNFFQWAENGPGI
KIIPGC
Download sequence
Identical sequences G3RKV9
ENSGGOP00000016391 ENSGGOP00000016391 XP_004040711.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]