SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016456 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000016456
Domain Number - Region: 188-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000108
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number - Region: 240-286
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0183
Family RILP dimerisation region 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016456   Gene: ENSGGOG00000016859   Transcript: ENSGGOT00000016921
Sequence length 869
Comment pep:known_by_projection chromosome:gorGor3.1:13:78564564:78627893:-1 gene:ENSGGOG00000016859 transcript:ENSGGOT00000016921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAEAANWFSSMPFQKHVYYPLASGPEGPDVAVAAAAAGAASMACAPPSTASGPLPFFQF
RPRLESVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVDPVLLKL
IRLAQFTIEYLLHSQEFLTSQLHTLEERLRLSHCDGEQSKKLLTKQAGEIKTLKEECKRR
KKMISTQQLMIEAKANYYQCHFCDKAFMNQAFLQSHIQRRHTEENSRFATEYQKNAQIEK
LRSEIVVLKEELQLTRSELEAAHHTSAVRFSKEYEMQKTKEEDFLKLFDRWKEEEKEKLV
DEMEKVKEMFMKEFKELTSKNSALEYQLSEIQKSNMQIKSNIGTLKDAHEFKEDRSPYPQ
DFHNVMQLLDSQESKWTARVQAIHQEHKKEKGRLLSHIEKLRTSMIDDLNASNVFYKKRI
EELGQRLQEQNELIITQRQQIKDFTCNPLNSISEPKGNPLAWQAFESQPAAPAVPMNAPA
LHTLETKSSLPMVHEQAFSSHILEPIEELSEEEKGRENEQKLNNNKMHLRKALKSNSSLT
KGLRIMVEQNLMEKLETLGINADIRGISSDQLHRVLKSVESERHKQEREIPNFHQIREFL
EHQVSCKIEEKALLSSDQCSVSQMDTLSTGEVPKMIQLPSKNRQLVRQKAVSTDRASVPK
IKKNVMEDPFPRKSSTITTPPFSSEEEQEDDDLIRAYASPGPLPVPPSQNKGSFGKNTVK
SDADGTEGSEIEDTDDSPKPAGVAVKIPTEKVEKMFPHRKNVNKPVGGTNVPEMFIKKEE
LQELKCADVEDEDWDISSLEEEISLGKKSGKEQKEPPPVKNEPHFAHVLNAWGAFNPKGP
KGEGLQENESSTLKSSLVTVTDWSDTSDV
Download sequence
Identical sequences ENSGGOP00000016456 ENSGGOP00000016456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]