SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016564 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016564
Domain Number 1 Region: 234-321
Classification Level Classification E-value
Superfamily Immunoglobulin 1.8e-17
Family I set domains 0.033
Further Details:      
 
Domain Number 2 Region: 515-575,624-703
Classification Level Classification E-value
Superfamily Immunoglobulin 2.54e-16
Family I set domains 0.026
Further Details:      
 
Domain Number 3 Region: 1088-1149,1193-1257
Classification Level Classification E-value
Superfamily Immunoglobulin 6.1e-16
Family I set domains 0.063
Further Details:      
 
Domain Number 4 Region: 709-774,817-894
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000176
Family I set domains 0.058
Further Details:      
 
Domain Number 5 Region: 895-981
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000681
Family I set domains 0.05
Further Details:      
 
Domain Number 6 Region: 1453-1511,1554-1630
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000144
Family I set domains 0.029
Further Details:      
 
Domain Number 7 Region: 24-136
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000173
Family V set domains (antibody variable domain-like) 0.00000468
Further Details:      
 
Domain Number 8 Region: 327-412
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000414
Family I set domains 0.025
Further Details:      
 
Domain Number 9 Region: 1267-1324,1367-1443
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000307
Family I set domains 0.028
Further Details:      
 
Domain Number 10 Region: 977-1083
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000107
Family I set domains 0.042
Further Details:      
 
Domain Number 11 Region: 406-504
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000283
Family I set domains 0.047
Further Details:      
 
Domain Number 12 Region: 139-238
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000156
Family C1 set domains (antibody constant domain-like) 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016564   Gene: ENSGGOG00000016970   Transcript: ENSGGOT00000017030
Sequence length 1709
Comment pep:known_by_projection chromosome:gorGor3.1:20:3752554:3772723:-1 gene:ENSGGOG00000016970 transcript:ENSGGOT00000017030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFLPKLLLLASFFPAGQTSWGVSSPQDVQGVKGSCLLIPCIFSFPADVEVPDGITTIWY
YDYSGQRQVVSHSADPKLVEARFRGRTEFMGNPEHRVCNLLLKDLQPEDSGSYNFRFEIS
EVNRWSDVKGTLVTVTEEPRVPTIASPVELLEGTEVDFNCSTPYACLQEQVRLQWQGQDP
ARSVTFNSQKFEPTGVGHLETLHMAMSWQDHGRILRCQLSVANHRAQSEIHLQVKYAPKG
VKILLSPSGRNILPGELVTLTCQVNSSYPAVSSIKWLKDGVRLQTKTGVLHLPQAAWSDA
GVYTCQAENGVGSLVSAPASLHIFMAEVQVSPAGPILENQTVTLVCNTPNEAPSNLRYSW
YKNHVLLEDAHSHTLRLHLATRADTGFYFCEVQNAHGSERSGPVSVVVNHPPLTPVLTAF
LETQAGLVGILHCSVVSEPLATLVLSHGGHILASTSGDSDHSPRFSGTSGPNSLRLEIRD
LEETDSGEYKCSATNSLGNATSTLDFHANAARLLISPAAEVVEGQAVTLSCRSGLSPTPD
ARFSWYLNGALLHEGPGSSLLLPAASSTDAGSYHCRARDGHSASGPSSPAVLTVLYPPRQ
PTFTTRLDLDAAGAGAGRRGLLLCRVDSDPPARLQLLHKDHVVATSLPSGGGCSTCGGCS
PRMKVTKAPNLLRVEIHNPLLEEEGLYLCEASNALGNASISATFNGQATVLAIAPSHTLQ
EGTEANLTCNVSREAAGSPANFSWFRNGVLWAQGPLETVTLLPVARTDAALYACRILTEA
GAQLSTPVLLSVLYPPDPPKLSALLDMGQGHMALFICTVDSRPLALLALFHGEHLLATSL
GPQVPSHGRFQAKAEANSLKLEVRELGLGDSGSYRCEATNVLGSSNTSLFFQVRGAWVQV
SPSPELQEGQAVVLSCQVPTGVPEGTSYRWYRDGQPLQESTSATLRFAAITLTQAGAYHC
QAQAPGSATTSLAAPISLHVSYAPRHITLTTLMDTGPGRLGLLLCRVDSDPPAQLRLLHG
DRLVASTLQGVGGPEGSSPRLHVAVAPNTLRLEIHGAMLEDEGVYICEASNTLGQASASA
DFHAQAVNVQVWPGATVREGQLVNLTCLVWTTHPAQLTYTWYQDGQQRLDAHSILLPNVT
VRDATSYRCGVGPPGQAPRLSRPITLDVLYAPRNLRLTYLLESHGGQLALVLCTVDSRPP
AQLALSHAGRLLASSTAASVPNTLRLELREPQPSDEGFYSCSARSPLGQANTSLELRLEG
VRVILAPEATVPEGAPITVTCEDPAARAPTLYTWYHNGRWLQEGPAASLSFLVATRAHAG
AYSCQAQDAQGTRSSRPAALQVLYAPQDAVLSSFRDSRARSMAVIQCTVDSEPPAELALS
HDGKVLATSSGVHSLASGTGHVQVARNALRLQVQDVPAGDDTYVCTAQNLLGSISTTGRL
QVEGARVVAEPGLDVPEGAALNLSCRLLGGPGPVGNSTFAWFWNDRRLHAEPLPTLAFTH
VARAQAGMYHCLAELPTGAAASAPVMLRVLYPPRTPTMMVFVEPEGGLRGILDCRVDSEP
LASLTLHLGSRLVASSQPQGAPAEPHIHVLASPNALRVDIEALRPSDQGEYVCSASNVLG
SASTSTYFGVRALHRLHQFQQLLWVLGLLVGLLLLLLGLGACYTWRRRRVCKQSMGENSV
EMAFQKETTQLIDPDAATCETSTCAPPLG
Download sequence
Identical sequences G3RLC1
ENSGGOP00000016564 ENSGGOP00000016564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]