SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016696 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016696
Domain Number 1 Region: 1-378
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 7.89e-153
Family Phosphoglycerate kinase 0.00000000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016696   Gene: ENSGGOG00000017111   Transcript: ENSGGOT00000017167
Sequence length 379
Comment pep:known_by_projection chromosome:gorGor3.1:X:75196608:75220011:1 gene:ENSGGOG00000017111 transcript:ENSGGOT00000017167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIKAAVPSIKFCLDNGAKSVVLMSHLGRPDGVPMPDKYSLEPVAVELKSLLGKDVLFLKD
CVGPEVEKACANPAAGSVILLENLRFHVEEEGKGKDASGNKVKAEPAKIEAFRASLSKLG
DVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVA
DKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGV
KITLPVDFVTADKFDENAKTGQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNG
PVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGA
SLELLEGKVLPGVDALSNI
Download sequence
Identical sequences ENSGGOP00000016696 ENSGGOP00000016696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]