SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016758 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016758
Domain Number 1 Region: 13-70,98-158
Classification Level Classification E-value
Superfamily POZ domain 1.29e-27
Family BTB/POZ domain 0.001
Further Details:      
 
Domain Number 2 Region: 354-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000106
Family Classic zinc finger, C2H2 0.00082
Further Details:      
 
Domain Number 3 Region: 392-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000228
Family Classic zinc finger, C2H2 0.00068
Further Details:      
 
Domain Number 4 Region: 465-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000387
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 5 Region: 594-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000643
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016758
Domain Number - Region: 291-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00196
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016758   Gene: ENSGGOG00000017171   Transcript: ENSGGOT00000017229
Sequence length 687
Comment pep:known_by_projection chromosome:gorGor3.1:22:15481003:15501388:-1 gene:ENSGGOG00000017171 transcript:ENSGGOT00000017229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERVNDASCGPSGCYTYQVSRHSTEMLHNLNQQRKNGGRFCDVLLRVGDESFPAHRAVLA
ACSEYFESVFSAQLGDGGAADGGPADVGGATAAPGGGAGGSRELEMHTISSKVFGDILDF
AYTSRIVVRLESFPELMTAAKFLLMRSVIEICQEVIKQSNVQILVPPARADIMLFRPPGT
SDLGFPLDMTNGAALAANSNGIAGSMQPEEEAARAAGAAIAGQASLPVLPGVDRLPMVAG
PLSPQLLTSPFPNVASSAPPLTGKRGRGRPRKANLLDSMFGSPGGLREAGILPCGLCGKV
FTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACEIC
GKIFRDVYHLNRHKLSHSGEKPYSCPVCGLRFKRKDRMSYHVRSHDGSVGKPYICQSCGK
GFSRPDHLNGHIKQVHTSERPHKCQTCNASFATRDRLRSHLACHEDKVPCQVCGKYLRAA
YMADHLKKHSEGPSNFCSICNRGFSSASYLKVHVKTHHGVPLPQVSRHQEPILNGGAAFH
CARTYGNKEGQKCSHQDPIESSDSYGDLSDASDLKTPEKQSANGSFSCDMAVPKNKMESD
GEKKYPCPECGSFFRSKSYLNKHIQKVHVRALGGPLGDLGPALGSPFSPQQNMSLLESFG
FQIVQSAFASSLVDPEVDQQPMGPEGK
Download sequence
Identical sequences G3RLU7 H2QLI5
ENSPTRP00000024578 9598.ENSPTRP00000024578 ENSPTRP00000024578 ENSGGOP00000016758 XP_003821517.1.60992 XP_004063373.1.27298 XP_525568.3.37143 ENSGGOP00000016758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]