SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016766 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016766
Domain Number 1 Region: 9-124
Classification Level Classification E-value
Superfamily POZ domain 1.26e-29
Family BTB/POZ domain 0.0015
Further Details:      
 
Domain Number 2 Region: 394-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000106
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 363-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000212
Family Classic zinc finger, C2H2 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016766   Gene: ENSGGOG00000017180   Transcript: ENSGGOT00000017238
Sequence length 467
Comment pep:known_by_projection chromosome:gorGor3.1:9:110265810:110295993:1 gene:ENSGGOG00000017180 transcript:ENSGGOT00000017238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGTNSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVLAASSPYFCD
QVLLKNSRRIVLPDVMNPRVFENILLSSYTGRLVMPAPEIVSYLTAASFLQMWHVVDKCT
EVLEGNPTVLCQKLNHGSDHQSPSSSSYNGLVESFELGSGGHTDFPKAQELRDGENEEES
TKDELSSQLTEHEYLPSNSSTEHDRLSTEMASQDGEEGASDSAEFHYTRPMYSKPSIMAH
KRWIHVKPERLEQACEGMDVHATYDEHQVTESINTVQTEHTVQPSGVEEDFHIGEKKVEA
EFDEQADESNYDEQVDFYGSSMEEFSGERSDGNLIGHRQEAALAAGYSENIEMVTGIKEE
ASHLGFSATDKLYPCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMK
IHTGIKPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTEAN
Download sequence
Identical sequences G3RLV5 H2PTF1 H2QXW7 O43298
NP_001129248.1.87134 NP_001129248.1.92137 NP_054726.1.87134 NP_054726.1.92137 XP_002820266.1.23681 XP_003312360.1.37143 XP_003312361.1.37143 XP_003808081.1.60992 XP_003808082.1.60992 XP_004048666.1.27298 XP_005251892.1.92137 XP_009455577.1.37143 XP_011516711.1.92137 XP_011516713.1.92137 XP_018889719.1.27298 ENSP00000362556 ENSP00000362563 ENSP00000390344 9598.ENSPTRP00000036534 9600.ENSPPYP00000021981 9606.ENSP00000362556 ENSPTRP00000036534 ENSP00000362556 ENSP00000362563 ENSP00000390344 ENSP00000362556 ENSPPYP00000021981 ENSGGOP00000016766 gi|209413766|ref|NP_001129248.1| gi|7662100|ref|NP_054726.1| ENSPTRP00000036534 ENSPPYP00000021981 ENSGGOP00000016766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]