SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016860 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016860
Domain Number 1 Region: 35-140
Classification Level Classification E-value
Superfamily Immunoglobulin 1.44e-23
Family V set domains (antibody variable domain-like) 0.00065
Further Details:      
 
Domain Number 2 Region: 144-233
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-16
Family I set domains 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016860   Gene: ENSGGOG00000012684   Transcript: ENSGGOT00000026773
Sequence length 264
Comment pep:known_by_projection chromosome:gorGor3.1:19:39922405:39933802:-1 gene:ENSGGOG00000012684 transcript:ENSGGOT00000026773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQ
DPRGYNWYKGETVDANRRITGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSY
TLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWV
NGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIRNPASANFSDPVTLNVLYALVQG
SSPGLSARATVSIMIGVLARVALI
Download sequence
Identical sequences XP_018870297.1.27298 ENSGGOP00000016860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]