SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016877 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016877
Domain Number 1 Region: 1802-2054
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.82e-94
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000308
Further Details:      
 
Domain Number 2 Region: 271-379
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-33
Family Second domain of FERM 0.0002
Further Details:      
 
Domain Number 3 Region: 958-1065
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-28
Family PDZ domain 0.0000187
Further Details:      
 
Domain Number 4 Region: 685-789
Classification Level Classification E-value
Superfamily PDZ domain-like 5.78e-27
Family PDZ domain 0.0073
Further Details:      
 
Domain Number 5 Region: 381-487
Classification Level Classification E-value
Superfamily PH domain-like 1.94e-26
Family Third domain of FERM 0.0022
Further Details:      
 
Domain Number 6 Region: 1377-1466
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-22
Family PDZ domain 0.015
Further Details:      
 
Domain Number 7 Region: 1099-1202
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-20
Family PDZ domain 0.028
Further Details:      
 
Domain Number 8 Region: 1468-1559
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-17
Family PDZ domain 0.041
Further Details:      
 
Domain Number 9 Region: 177-270
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.93e-17
Family First domain of FERM 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016877   Gene: ENSGGOG00000025765   Transcript: ENSGGOT00000030196
Sequence length 2070
Comment pep:known_by_projection chromosome:gorGor3.1:4:95521109:95750615:1 gene:ENSGGOG00000025765 transcript:ENSGGOT00000030196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVEEPVRRYKTYHGDAFSTSSESPSIISSESDFRQVRRSEASKRFESSSGLPGVDETLS
QGQSQRPSRQYETPFEGNLINQEIMLKRQEEELMQLQAKMALRQSRLSLYPGDTIKASML
DITRDPLREIALETAMTQRKLRNFFGPEFVKMTIEPFISLDLPRSILTKKGKNEDNRRKV
NIMLLNGQRLELTCDTKTICKDVFDMVVAHIGLVEHHLFALATLKDNEYFFVDPDLKLTK
VAPEGWKEEPKKKTKATVNFTLFFRIKFFMDDVSLIQHTLTCHQYYLQLRKDILEERMHC
DDETSLLLASLALQAEYGDYQPEVHGVSYFRMEHYLPARVMEKLDLSYIKEELPKLHNTY
VGASEKETELEFLKVCQRLTEYGVHFHRVHPEKKSQTGILLGVCSKGVLVFEVHNGVRTL
VLRFPWRETKKISFSKKKITLQNTSDGIKHAFQTDNSKICQYLLHLCSYQHKFQLQMRAR
QSNQDAQDIERASFRSLNLQAESVRGFNMGRAISTGSLASSTLNKLAVRPLSVQAEILKR
LSCSELSLYQPLQNSSKEKNDKASWEEKPREMSKSYHDLSQASLYPHRKNVVVNMEPPPQ
TVAELVGKPSHQMSRSDAESLAGVTKLNNSKSVASLNRSPERRKHESDSSSIEDPGQAYV
LGMTMHSSGNSSSQVPLKENVDVLHKRWSIVSSPEREITLVNLKKDAKYGLGFQIIGGEK
MGRLDLGIFISSVAPGGPADLDGCLKPGDRLISVNSVSLEGVSHHAAIEILQNAPEDVTL
VISQPKEKISKVPSTPVHLTNEMKNYMKKSSYVQDSAIDSSSKDHHWSRGTLRHISENSF
GLSGGLREGSLSSQDSRTESASLSQSQVNGFFASHLGDQTWQESQHGSPSPSVISKATEK
ETFTDSNQSKTKKPGISDATDYSDRGDSDMDEATYSSSQDHQTPKQESSSSVNTSNKMNF
KTFSSSPPKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIH
KGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPTSKEHVLVTPQCTLSDQN
AQGQGPEKVKKTTQVKDYSFVTEENTFEVKLFKNSSGLGFSFSREDNLIPEQINASIVRV
KKLFPGQPAAESGKIDVGDVILKVNGASLKGLSQQEVISALRGTAPEVFLLLCRPPPGVL
PEIDTALLTPLQSPAQVLPNSSKDSSQPSCVEQSTSSDENEMSDKSKKQCKSPSRRDSYS
DSSGSGEDDLVTAPATLSNMVSQAQSHREAPKSQEDTICTMFYYPQKIPNKPEFEDSNPS
PLPPDMAPGQSYQPQSESASSSSMDKYHIHHISEPTRQENWTPLKNDLENHLKDFELEVE
LLITLIKSEKGSLGFTVTKGNQRIGCYVHDVIQDPAKSDGRLKPGDRLIKVNDTDVTNMT
HTDAVNLLRAASKTVRLVIGRVLELPRIPMLPHLLPDITLTCNKEELGFSLCGGHDSLYQ
VVYISDINPRSVAAIEGNLQLLDVIHYVNGVSTQGMTLEEVNRALDMSLPSLVLKATRND
LPVVPSSKRSAVSAPKYSKVNIGSYSVGSCSQPALTPNDSFSTVAGEEINEISYPKGKCS
TYQIKGSPNLTLSKESYIQEDDIYDDSQEAEVIQSLLDVVDEEAQNLLNENNAAGNSCGP
GTLKMNGKLSEERTEDTDCDGSPLPEYFTETRNIYEGKVFYLSLIQKSQEKKTDDDEITW
GNDELPIERTNHEDSDKDSEFVTIEEIHWIPIINVCPSSKQQWLRALAPVVSWHCPYLPL
EKNLQELKPLDQCLIGQTKENRRKNRYKNILPYDATRVPLGDEGGYINASFIKIPVGKEE
FVYIACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRYWPNILGKTTMVSNR
LRLALVRMQQLKGFVVRAMTLEDIQTREVRHISHLNFTAWPDHDTPSQPDDLLTFISYMR
HIHRSGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQRHGMVQTEDQ
YIFCYQVILYVLTRLQAEEEQKQQPQLLNP
Download sequence
Identical sequences ENSGGOP00000016877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]