SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016887 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016887
Domain Number 1 Region: 36-291
Classification Level Classification E-value
Superfamily L domain-like 1.8e-46
Family Ngr ectodomain-like 0.037
Further Details:      
 
Domain Number 2 Region: 284-374
Classification Level Classification E-value
Superfamily Immunoglobulin 2.65e-18
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 422-495
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000126
Family Fibronectin type III 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016887   Gene: ENSGGOG00000022719   Transcript: ENSGGOT00000024799
Sequence length 719
Comment pep:known_by_projection chromosome:gorGor3.1:14:23229309:23246972:1 gene:ENSGGOG00000022719 transcript:ENSGGOT00000024799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKILFYLFFIGIAVKAQICPKRCVCQILSPNLATLCAKKGLLFVPPNIDRRTVELRLAD
NFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFS
GLSNLHHLILNNNQLTLISSTAFDDVFALEELDLSYNNLETIPWDAVEKMVSLHTLSLDH
NMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPDPLFQRAQVLATSGIISPSTFALSFGGN
PLHCNCELLWLRRLSREDDLETCASPPLLTGRYFWSIPEEEFLCEPPLITRHTHEMRVLE
GQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYDNGTLDILITTVKDTGAFTCIAS
NPAGEATQIVDLHIIKLPHLLNSTNHIHEPDPGSSDISTSTKSGSNTSSSNGDTKLSQDK
IVVAEATSSTALLKFNFQRNIPGIRMFQIQYNGTYDDTLVYRMIPPTSKTFLVNNLAAGT
MYDLCVLAIYDDGITSLTATRVVGCIQFTTEQDYVRCHFMQSQFLGGTMIIIIGGIIVAS
VLVFIIILMIRYKVCNNNGQHKVTKVSNVYSQTNGAQIQGCSVTLPQSVSKQAVGHEENA
QCCKASSDNVIQSSETCSSQDSSTTTSALPPSWTSSTSVSQKQKRKTGTKPSTEPQNEAV
TNVESQNTNRNNSTALQLASRPPDSVTEGPTSKRAHIKPNALLTNVDQIVKETQRLELI
Download sequence
Identical sequences ENSGGOP00000016887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]