SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016915 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016915
Domain Number 1 Region: 246-666
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 6.58e-82
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00042
Further Details:      
 
Domain Number 2 Region: 108-244
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.8e-37
Family Ferredoxin domains from multidomain proteins 0.00024
Further Details:      
 
Domain Number 3 Region: 32-107
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.1e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016915   Gene: ENSGGOG00000001513   Transcript: ENSGGOT00000033448
Sequence length 733
Comment pep:known_by_projection chromosome:gorGor3.1:2b:94721754:94750488:-1 gene:ENSGGOG00000001513 transcript:ENSGGOT00000033448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRIPVRKALVGLSKSPKGCVRTTATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQI
PRFCYHERLSVAGNCRMCLVEIEKAPKKSQVVAACAMPVMKGWNILTNSEKSKKAREGVM
EFLLANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCI
QCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYA
FTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGL
KRQRLTEPMVRNEKGLLTYTSWEDALSRVAGMLQSFQGKDVAAIAGGLVDAEALVALKDL
LNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNAR
IRKSWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLG
SSALQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRFVEQLCRLFCAYKTKIYEL
NPVPTKILFLVLLSSCTVENQFLIKFWFTIFHLCAGHHGDVGAPIADVILPGAAYTEKSA
TYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLV
RYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAV
TEGAQAVEEPSIC
Download sequence
Identical sequences ENSGGOP00000016915 ENSGGOP00000001494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]