SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017011 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017011
Domain Number 1 Region: 322-427,552-669
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.26e-53
Family Phosphate binding protein-like 0.000000051
Further Details:      
 
Domain Number 2 Region: 2-247
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.73e-23
Family L-arabinose binding protein-like 0.008
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000017011
Domain Number - Region: 493-525
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0432
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017011   Gene: ENSGGOG00000009965   Transcript: ENSGGOT00000023183
Sequence length 1355
Comment pep:known_by_projection chromosome:gorGor3.1:12:13669332:13867024:-1 gene:ENSGGOG00000009965 transcript:ENSGGOT00000023183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISDKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENS
FVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYIFEVANSVGLTGYG
YTWIVPSLVAGDTDTVPAEFPTGLISVSYDEWDYGLPARVRDGIAIITTAASDMLSEHSF
IPEPKSSCYNTHEKRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHPKLVIILLNKERKW
ERVGKWKDKSLQMKYYVWPRMCPETEEQEDDHLSIVTLEEAPFVIVESVDPLSGTCMRNT
VPCQKRIVTENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYLVTNGKHGKKINGT
WNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEP
FSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGRVMPEPGGPSFTIGKAIWLLW
GLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKK
FQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLSLKTGKLDAFI
YDAAVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAILQLFGDAGEM
EELEALWLTGICHNEKNEVMSSQLDIDNMAGVFYMLGAAMALSLITFICEHLFYWQFRHC
FMGVCSGKPGMVFSISRGIYSCIHGVAIEERQSVMNSPTATMNNTHSNILRLLRTAKNMA
NLSGVNGSPQSALDFIRRESSVYDISEHRRSFTHSDCKSYNNPPCEENLFSDYISEVERT
FGNLQLKDSNVYQDHYHHHHRPHSIGSASSIDGLYDCDNPPFTTQSRSISKKPLDIGLPS
SKHSQLSDLYGKFSFKSDRYSGHDDLIRSDVSDISTHTVTYGNIEGNAAKRRKQQYKDSL
KKRPASAKSRREFDEIELAYRRRPPRSPDHKRYFRDKEGLRDFYLDQFRTKENSPHWEHV
DLTDIYKERSDDFKRDSVSGGGPCTNRSHIKHGTGDKHGVVSGVPAPWEKNLTNVEWEDR
SGGNFCRSCPSKLHNYSTTVAGQNSGRQACIRCEACKKAGNLYDISEDNSLQELDQPAAP
VAVTSNASTTKYPQSPTNSKAQKKNRNKLRRQHSYDTFVDLQKEEAALAPRSVSLKDKGR
FMDGSPYAHMFEMSAGESTFANNKSSVPTAGHHHHNNPGGGYMLSKSLYPDRVTQNPFIP
TFGDDQCLLHGSKSYFFRQPTVAGASKARPDFRALVTNKPVVSALHGAVPARFQKDICIG
NQSNPCVPNNKNPRAFNGSSNGHVYEKLSSIESDV
Download sequence
Identical sequences ENSGGOP00000017011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]