SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017081 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017081
Domain Number 1 Region: 20-112
Classification Level Classification E-value
Superfamily Immunoglobulin 8.34e-25
Family I set domains 0.0023
Further Details:      
 
Domain Number 2 Region: 114-211
Classification Level Classification E-value
Superfamily Immunoglobulin 1.92e-23
Family I set domains 0.00000577
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017081   Gene: ENSGGOG00000005194   Transcript: ENSGGOT00000024351
Sequence length 371
Comment pep:known_by_projection chromosome:gorGor3.1:19:52342145:52358434:1 gene:ENSGGOG00000005194 transcript:ENSGGOT00000024351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACVGFLLLQGAWPHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFAIFSLYKEDGVP
VPELYDKIFWKSILLGPVTRAHAGTYRCRGSHPHSPIEWSAPSNPLVIVVTGVHRKPSLL
ALPGHLLKSEETVILQCWSDVRFEHFRLHREGKFEDTLHLIGELHDGVSKANFSIGPMTH
VLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGESAEAGGSPEARSSRPGWPTEHLHVLIG
TSVVIFLFILLLFFLLYRWCSNKKNAAVTDQEPAGDRTVNRQDSDEQDPQEVTYAQLDHC
VFTQRKISRPSQRPKTPPTDTSVYTELPNAEPRSLSPAHEHHSQALRGSSRETTALSQNR
VASSHVPAAGI
Download sequence
Identical sequences ENSGGOP00000017081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]