SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017087 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017087
Domain Number 1 Region: 321-498
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-55
Family SPRY domain 0.0000188
Further Details:      
 
Domain Number 2 Region: 40-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000298
Family V set domains (antibody variable domain-like) 0.00065
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000017087
Domain Number - Region: 166-239
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00068
Family C1 set domains (antibody constant domain-like) 0.031
Further Details:      
 
Domain Number - Region: 288-331
Classification Level Classification E-value
Superfamily BAG domain 0.000863
Family BAG domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017087   Gene: ENSGGOG00000012744   Transcript: ENSGGOT00000027574
Sequence length 528
Comment pep:known_by_projection chromosome:gorGor3.1:5:165601167:165615548:1 gene:ENSGGOG00000012744 transcript:ENSGGOT00000027574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDLPVSLDSLKPVSLTSSLVFLMHLLLLQPGEPSSEVKVLGPEYPILALVGEEVEFLCH
LWPQLDAQKMEICWFQSHTLNVVHLYQEQQELPGRQMQAFRNRTKLVKDDIAYGSVVLQL
HSIVPSDKGIYGCRFHSDNFSGEAFWELEVAALGSDPHLFLEGFKEGGIQLRLRSSGWYP
KPKVQWRDHQGQCLPPEFEAIVWDAQGLFSLETSVVVQEGALSNVSVSIQNLLLSQKKEF
VVQIADVFVPGASPWKSAFVATLPPLLLVLAALALGFLQKQRRSREKLKKQAEKRQEKLT
AELEKLQTELDWRRAEGQAEWRAAQKYAVDVTLDPASAHPSLQVSEDGKSVSSHPQRFSE
QTCALSLERFSAGRHYWEVHVGRRRRSRWFLGACLAAVPRAGPARLSPAAGYWVLGLWNG
CEYFVLAPHRVALTLRVPPRRLGVFLDYEAGKLSFFNVSDGSHIFTFHDTFSGALCAYFR
PRAHDGGEHPDPLTICPLPVRGTCVPEENDSDTWLQPYEPADPALDWW
Download sequence
Identical sequences ENSGGOP00000017087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]