SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017129 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017129
Domain Number 1 Region: 240-398
Classification Level Classification E-value
Superfamily Kelch motif 9.55e-29
Family Kelch motif 0.00032
Further Details:      
 
Domain Number 2 Region: 141-196
Classification Level Classification E-value
Superfamily POZ domain 0.00000000173
Family BTB/POZ domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017129   Gene: ENSGGOG00000022674   Transcript: ENSGGOT00000034136
Sequence length 451
Comment pep:known_by_projection chromosome:gorGor3.1:8:1879683:1881557:1 gene:ENSGGOG00000022674 transcript:ENSGGOT00000034136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHAVAPCVLYPGTEPGAAGESESEGAASPAQTPCSLGASLCFSSGEESPPQSLASAAEG
AATSPPSSGGPRVVERQWEAGSAGAASPEELASPEERACPEEPAAPSPEPRVWLEDPASP
EEPGEPAPVPPGFGAVYGEPDLVLEVSGRRLRAHKAVLAARSDYFRARASRDVLRVQGVS
LTALRLLLADAYSGRXAGLLXGAACAPAAHLLAAALGPAGERAGSRPQSPSGDADARGDA
AVYCFHAAAGEWRELTRLPEGAPARGCGLCVLYNYLFVAGGVAPAGPDGRARPSDQVFCY
NPATDSWSAVRPLRQARSQLRLLALDGHLYAVGGECLLSVERYDPRADRWAPVAPLPRGA
FAVAHEATTCHGEIPTGLQPFRCAALDGAIYCVSRAGTWRFQPAREGEAGGDAGQGGGFE
ALGAPLDVRGVLIPFALSLPEKPPRGEQGAA
Download sequence
Identical sequences ENSGGOP00000017129 ENSGGOP00000017129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]