SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017179 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017179
Domain Number 1 Region: 4792-5007
Classification Level Classification E-value
Superfamily GFP-like 5.86e-62
Family Domain G2 of nidogen-1 0.0008
Further Details:      
 
Domain Number 2 Region: 2391-2490
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-25
Family I set domains 0.0085
Further Details:      
 
Domain Number 3 Region: 2310-2398
Classification Level Classification E-value
Superfamily Immunoglobulin 9.5e-25
Family I set domains 0.019
Further Details:      
 
Domain Number 4 Region: 1081-1178
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-24
Family I set domains 0.0077
Further Details:      
 
Domain Number 5 Region: 3996-4093
Classification Level Classification E-value
Superfamily Immunoglobulin 3.91e-24
Family I set domains 0.015
Further Details:      
 
Domain Number 6 Region: 3549-3641
Classification Level Classification E-value
Superfamily Immunoglobulin 4.57e-24
Family I set domains 0.0065
Further Details:      
 
Domain Number 7 Region: 3159-3256
Classification Level Classification E-value
Superfamily Immunoglobulin 1.23e-23
Family I set domains 0.005
Further Details:      
 
Domain Number 8 Region: 2499-2586
Classification Level Classification E-value
Superfamily Immunoglobulin 1.43e-23
Family I set domains 0.0098
Further Details:      
 
Domain Number 9 Region: 2968-3069
Classification Level Classification E-value
Superfamily Immunoglobulin 2.23e-23
Family I set domains 0.0075
Further Details:      
 
Domain Number 10 Region: 2796-2884
Classification Level Classification E-value
Superfamily Immunoglobulin 4.16e-23
Family I set domains 0.0063
Further Details:      
 
Domain Number 11 Region: 2876-2975
Classification Level Classification E-value
Superfamily Immunoglobulin 5.3e-23
Family I set domains 0.0051
Further Details:      
 
Domain Number 12 Region: 2597-2685
Classification Level Classification E-value
Superfamily Immunoglobulin 8.5e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 13 Region: 3901-4000
Classification Level Classification E-value
Superfamily Immunoglobulin 8.83e-23
Family I set domains 0.033
Further Details:      
 
Domain Number 14 Region: 2216-2304
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-22
Family I set domains 0.016
Further Details:      
 
Domain Number 15 Region: 515-612
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-22
Family I set domains 0.02
Further Details:      
 
Domain Number 16 Region: 4269-4368
Classification Level Classification E-value
Superfamily Immunoglobulin 1.72e-22
Family I set domains 0.0096
Further Details:      
 
Domain Number 17 Region: 1364-1465
Classification Level Classification E-value
Superfamily Immunoglobulin 3.76e-22
Family I set domains 0.02
Further Details:      
 
Domain Number 18 Region: 3630-3728
Classification Level Classification E-value
Superfamily Immunoglobulin 4.19e-22
Family I set domains 0.016
Further Details:      
 
Domain Number 19 Region: 2706-2788
Classification Level Classification E-value
Superfamily Immunoglobulin 7.22e-22
Family I set domains 0.022
Further Details:      
 
Domain Number 20 Region: 1003-1094
Classification Level Classification E-value
Superfamily Immunoglobulin 7.64e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 21 Region: 3824-3916
Classification Level Classification E-value
Superfamily Immunoglobulin 8.58e-22
Family I set domains 0.019
Further Details:      
 
Domain Number 22 Region: 704-798
Classification Level Classification E-value
Superfamily Immunoglobulin 9.06e-22
Family I set domains 0.017
Further Details:      
 
Domain Number 23 Region: 2019-2114
Classification Level Classification E-value
Superfamily Immunoglobulin 1.31e-21
Family I set domains 0.007
Further Details:      
 
Domain Number 24 Region: 1738-1837
Classification Level Classification E-value
Superfamily Immunoglobulin 1.57e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 25 Region: 1283-1372
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-21
Family I set domains 0.018
Further Details:      
 
Domain Number 26 Region: 4086-4184
Classification Level Classification E-value
Superfamily Immunoglobulin 2.43e-21
Family I set domains 0.019
Further Details:      
 
Domain Number 27 Region: 3722-3821
Classification Level Classification E-value
Superfamily Immunoglobulin 4.75e-21
Family I set domains 0.0056
Further Details:      
 
Domain Number 28 Region: 4172-4270
Classification Level Classification E-value
Superfamily Immunoglobulin 8.36e-21
Family I set domains 0.017
Further Details:      
 
Domain Number 29 Region: 3067-3164
Classification Level Classification E-value
Superfamily Immunoglobulin 1.2e-20
Family I set domains 0.0095
Further Details:      
 
Domain Number 30 Region: 1459-1558
Classification Level Classification E-value
Superfamily Immunoglobulin 1.23e-20
Family I set domains 0.0039
Further Details:      
 
Domain Number 31 Region: 1925-2024
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 32 Region: 1662-1745
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-20
Family I set domains 0.016
Further Details:      
 
Domain Number 33 Region: 3437-3539
Classification Level Classification E-value
Superfamily Immunoglobulin 4.04e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 34 Region: 3363-3449
Classification Level Classification E-value
Superfamily Immunoglobulin 6.25e-20
Family I set domains 0.0092
Further Details:      
 
Domain Number 35 Region: 4352-4449
Classification Level Classification E-value
Superfamily Immunoglobulin 7.25e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 36 Region: 1194-1278
Classification Level Classification E-value
Superfamily Immunoglobulin 8.32e-20
Family I set domains 0.0057
Further Details:      
 
Domain Number 37 Region: 430-529
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-19
Family I set domains 0.053
Further Details:      
 
Domain Number 38 Region: 3272-3355
Classification Level Classification E-value
Superfamily Immunoglobulin 2.13e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 39 Region: 1846-1931
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-19
Family I set domains 0.015
Further Details:      
 
Domain Number 40 Region: 1551-1652
Classification Level Classification E-value
Superfamily Immunoglobulin 3.43e-19
Family I set domains 0.0044
Further Details:      
 
Domain Number 41 Region: 2108-2209
Classification Level Classification E-value
Superfamily Immunoglobulin 1.36e-18
Family I set domains 0.0084
Further Details:      
 
Domain Number 42 Region: 613-711
Classification Level Classification E-value
Superfamily Immunoglobulin 2.11e-17
Family I set domains 0.025
Further Details:      
 
Domain Number 43 Region: 898-991
Classification Level Classification E-value
Superfamily Immunoglobulin 3.05e-17
Family I set domains 0.0082
Further Details:      
 
Domain Number 44 Region: 5013-5158
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.47e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 45 Region: 4561-4619
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000144
Family TSP-1 type 1 repeat 0.00017
Further Details:      
 
Domain Number 46 Region: 4449-4505
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000109
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 47 Region: 4504-4562
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000123
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 48 Region: 4733-4790
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000126
Family TSP-1 type 1 repeat 0.00026
Further Details:      
 
Domain Number 49 Region: 4619-4676
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000628
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 50 Region: 6-128
Classification Level Classification E-value
Superfamily vWA-like 0.000000000000204
Family Integrin A (or I) domain 0.022
Further Details:      
 
Domain Number 51 Region: 4675-4733
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000785
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 52 Region: 5158-5276
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000235
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 53 Region: 5333-5449
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000549
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 54 Region: 845-900
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000014
Family I set domains 0.049
Further Details:      
 
Domain Number 55 Region: 357-435
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000722
Family I set domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017179   Gene: ENSGGOG00000001656   Transcript: ENSGGOT00000026138
Sequence length 5557
Comment pep:known_by_projection chromosome:gorGor3.1:1:165467891:165809652:1 gene:ENSGGOG00000001656 transcript:ENSGGOT00000026138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIGPVTITTDPKKFQYELRELYVQGGGDCPEMSIGAIKIALEISLPGSFIYVFTDARSKD
YRLTHDVLQLIQQKQSQVVFVLTGDCDDRTHIGYKVYEEIASTSSGQVFHLDKKQVNEVL
KWVEEAVQASKVHLLSTDHLEQAVNTWRIPFDPSLKEVTVSLSGPSPMIEIRNPLGKLIK
KRFGLHELLNIHNSAKVVNVKEPEAGMWTVKISSSGRHSVRITGLSTIDFRAGFSRKPTL
DFKKTVSRPVQGIPTYVLLNTSGISTPARIDLLELLSISGSSLKTIPVKYYPDRKPYGIW
NISDFVPPNEAFFLKVTGYDKDDYLFQRVSSVSFSSIVPVDAPKVTMPEKTPGYYLQPGQ
IPCSVDSLLPFTLSFVRNGVTLGVDQYLKESASVNLDIEKVTLSDKGFYECIAVSSAGTG
RAQTFFDVSEPPPVIQVPNNVTVTPGERAVLTCLIISAVDYNLTWQRNDRDVRLAEPARI
RTLANLSLELKSVKFNDAGEYHCMVSSEGGSSAASVFLTVQEPPKVTVMPKNQSFTGGSE
VSIMCSATGYPKPKIAWTVNDMFIVGSHRYRMTSDGTLFIKNAAPKDAGIYGCLASNSAG
RDKQNSTLRYIEAPKLMVVQSELLVALGDITVMECKTSGIPPPQVKWFKGDLELRSSTFL
IIDPLLGLLKIQETQDLDAGDYTCVAINEAGRATGKITLDVGSPPVFIQEPADVSMEIGS
NVTLPCYVQGYPEPTIKWRRLDNMPIFSRPFSVSSISQLRTGALFILNLWASDKGTYICE
AENQFGKIQSETTVTVTGLEYPFDHVKPQLLCIIFGGMSGLNCTITLLTFSNPVGKKRKN
YLFFSFKLLQNPYITVRSDGSLHIERVQLQDGGEYTCVASNVAGTNNKTTSVVVHVLPTI
QHGQQILSTIEGIPVTLPCKASGIPKPSVIWSKKGELISTSSAKFSAGADGSLYVVSPGG
EESGEYVCTATNAAGYAKRKVQLTVYVRPRVFGDQRGLSQDKPVEISVLAGEEVTLPCEV
KSLPPPIITWAKETQLISPFSPRHTFLPSGSMKITETRTSDSGMYLCVATNIAGNVTQAV
KLNVHVPPKIQRGPKHLKVQVGQRVDIPCNAQGTPLPVITWSKGGSTMLVDGEHHVSNPD
GTLSIDQAMPSDAGIYTCVATNIAGTDETEITLHVQEPPTVEDLEPPYNTPFQERVANQR
IAFPCPAKGTPKPTIKWLHNGRELTGREPGISILEDGTLLVIASVTPYDSGEYICVAVNE
AGTTEIKYNLKVHVPPVIKDKEQVTNVSVLLNQLTNLFCEVEGTPSPIIMWYKDNVQVTE
SSTIQIVNNGKILKLFKATPEDAGRYSCKAINIAGTSQKYFNIDVLVPPTIIGTNFPNEV
SVVLNRDVTLECQVKGTPFPDIHWFKDGKPLFLGDPNVELLDRGQVLHLKNARRNDKGRY
QCTVSNAAGKQAKDIKLTIYIPPSIKGGNVTTDISVLINSLIKLECETRGLPMPAITWYK
DGQPIMSSSQALYIDKGQYLHIPRAQVSDSATYVCHVANVAGTAEKSFHVDVYVPPMIEG
NLATPLNKQVVIAHSLTLECKAAGNPSPILTWLKDGVPVKANDNIRIEAGGKKLEIMSAQ
EIDRGQYICVATSVAGEKEIKYEVDVLVPPAIEGGDETSYFIVMVNNLLELDCHVTGSPP
PTIMWLKDGQSIDERDGFKILLNGRKLVVAQAQVSDTGLYRCMAANTAGDHKKEFEVTVH
VPPTIKSSGLSERVVVKYKPVALQCIANGIPNPSITWLKDDQPVNTAQGNLKIQSSGRLL
QIAKTLLEDAGRYTCVATNAAGETQQHIQLHVHEPPSLEDAGKMLNETVLVSNPVQLECK
AAGNPVPVITWYKDNRLLSGSTSMIFLNRGQIIDIESAQISDAGIYKCVAINSAGATELF
YSLQVHVAPSISGSNNMVAVVVNNPVRLECEARGIPAPSLTWLKDGSPVSSFSNGLQVLS
GGRILALTSAQISDTGRYTCVAVNAAGEKQRDIDLRVYVPPNIVGEEQNVSVLISQAVEL
LCQSDAIPPPTLTWLKDGHPLLKKPGLSISENGSVLKIEDAQVQDTGRYTCEATNVAGKT
EKNYNVNIWVPPNIGGSDELTQLTVIEGNLISLLCESSGIPPPNLIWKKKGSPVLTDSMG
RVRILSGGRQLQISIAEKSDTALYSCVASNVAGTAKKEYNLQVYIRPTITNSGSHPTEII
VTRGKSISLECEVQGIPPPTVTWMKDGRPLIKAKGVEILDEGHILQLKNIHVSDTGRYVC
VAVNVAGMTDKKYDLSVHAPPSIIGNHRSPENISVVEKNSVTLTCEASGIPLPSITWFKD
GWPVSLSNSVRILSGGRMLRLMQTTMEDAGQYTCVVRNAAGEERKIFGLSVLVPPHIVGE
NTLEDVKVKEKQSVTLTCEVTGNPVPEITWHKDGQPLQEDEAHHIISGGRFLQITNVQVP
HTGRYTCLASSPAGDKSRSFSLNVFVSPTIAGVGSDGNPEDVTVILNSPTSLVCEAYSYP
PATITWFKDGTPLESNRNIRILPGGRTLQILNAQEDNAGRYSCVATNEAGEMIKHYEVKV
YIPPIINKGDLWGPGLSPKEVKIKVNNTLTLECEAYAIPSASLSWYKDGQPLKSDDHVNI
AANGHTLQIKEAQISDTGRYTCVASNIAGEDELDFDVNIQVPPSFQKLWEIGNMLDTGRN
GEAKDVIINNPISLYCETNAAPPPTLTWYKDGHPLTSSDKVLILPGGRVLQIPRAKVEDA
GRYTCVAVNEAGEDSLQYDVRVLVPPIIKGANSDLPEEVTVLVNKSALMECLSSGSPAPR
NSWQKDGQPLLEDDHHKFLSNGRILQILNTQITDIGRYVCVAENTAGSAKKYFNLNVHVP
PSVIGPKSENLTVVVNNFISLTCEVSGFPPPDLSWLKNEQPIKLNTNALIVPGGRTLQII
RAKVSDGGEYTCIAINQAGESKKKFSLTVYVPPSIKDHDSESLSVVNVREGTSVSLECES
NAVPPPVITWYKNGRMITESTHVEILADGQMLHIKKAEVSDTGQYVCRAINVAGRDDKNF
HLNVYAVPPSIEGPEREVIVETISNPVTLTCDATGIPPPTIAWLKNRKRIENSDSLEVHI
LSGGSKLQIARSQHSDSGNYTCIASNMEGKAQKYYFLSIQVPPSVAGAEIPSDVSVLLGE
NVELVCNANGIPTPLIQWLKDGKPIASGETERIRVSANGSTLNIYGALTSDTGKYTCVAT
NPAGEEDRIFNLNVYDIVTPTIRGNKDEAEKLMTFVDTSINIECRATGTPPPQINWLKNG
LPLPLSSHIRLLAAGQVIRIVRAQVSDVAVYTCVASNRAGVDNKHYNLQVFAPPNMDNSM
GTEEITILKGTSTSMACITDGTPAPSMAWLRDGQPLGLDAHLTVSTHGMVLQLVKAETED
SGKYTCIASNEAGEVSKHFILKVLEPPHINGSEEHEEISVIVNNPLELTCIASGIPAPKM
TWMKDGRPLPQTDQVQTLGGGEVLRISTAQVEDTGRYTCLASSPAGDDDKEYLVRVHDPV
PPNIAGTDEPQDITVLRNRQVTLECKSDAVPPPVITWLRNGEWLQATPRVRILSGGRYLQ
INNADLGDTANYTCVASNIAGKTTREFILTVNVPPNIKGGPQSLVILLNKSTVLECIAEG
VPTPRITWRKDGAVLAGNHARYSILENGFLHIQSAHVTDTGRYLCMATNAAGTDRRRIDL
QVHVPPSVAPGPTNMTVTVNVQTTLACEATGIPKPSINWRKNGHLLNVDQNQNSYRLLSS
GSLVIISPSVDDTATYECTVTNGAGDDKRTVDLTVQVPPSIADEPTDFLVTKHAPAVITC
TASGVPFPSIHWTKNGIRLLPRGDGYRILSSGAIEILATQLNHAGRYTCVARNAAGSAHR
HVILHVHEPPVIQPQPSELHVILNNPILLPCEATGTPSPFITWQKEGINVNTSGRNHAVL
PSGGLQISRAVREDAGTYMCVAQNPAGTALGKIKLNVQVPPVISPHLKEYVIAVDKPITL
SCEADGLPPPDITWHKDGRAIVESIRQRVLSSGSLQIAFVQPGDAGHYTCMAANVAGSSS
TSTKLTVHVPPRIRSTEGHYTVNENSQAILPCVADGIPTPAINWKKDNVLLANLLGKYTA
EPYGELILENVVLEDSGFYTCVANNAAGEDTHTVSLTVHVLPTFTELPGDVSLNKGEQLR
LSCKATGIPLPKLTWTFNNNIIPAHFDSVNGHSELVIERVSKEDSGTYVCTAENSVGFVK
AIGFVYVKEPPVFKGDYPSNWIEPLGGNAILNCEVKGDPTPTIQWNRKGVDIEISHRIRQ
LGNGSLAIYGTVNEDAGDYTCVATNEAGVVERSMSLTLQSPPVITLEPVETVINAGGKII
LNCQATGEPQPTITWSRQGHSISWDDRVNVLSNNSLYIADAQKEDTSEFECVARNLMGSV
LVRVPVIVQVHGGFSQWSAWRACSVTCGKGIQKRSRLCNQPLPANGGKPCQGSDLEMRNC
QNKPCPVDGSWSEWSLWEECTRSCGRGNRTRTRTCNNPSVQHGGRPCEGNAVEIIMCNIR
PCPVHGAWSAWQPWGTCSESCGKGTQTRARLCNNPPPAFGGSYCDGAETQMQVCNERHCP
IHGKWATWASWSACSVSCGGGARQRTRDCSDPVPQYGGRKCEGSDVQSDFCNSDPCPTHG
NWSPWSGWGTCSRMCNGGQMRRYRTCDNPPPSNGGRACGGPDSQIQRCNTDMCPVDGSWG
SWHSWSQCSASCGGGEKTRKRLCDHPVPVKGGHPCPGDTTQVTRCNVQACPGGPQRARGS
VIGNINDVEFGIAFLNATITDSPNSDTRIIRAKITNVPRSLGSAMRKIVSILNPIYWTTA
KEIGEAVNGFTLTNAVFKRETQVEFATGEILQMSHIARGLDSDGALLLDIVVSGYVLQLQ
SPAEVTVKDYTEDYIQTGPGQLYAYSTRLFTIDGISIPYTWNHTVFYDQAQGRMPFLVET
LHASSVESDYNQIEETLGFKIHASISKGDRSNQCPSGFTLDSVGPFCADEDECAAGNPCS
HTCHNAMGTYYCSCPKGLTIAADGRTCQDIDECALGRHTCHAGQDCDNTIGSYRCVVRCG
SGFRRTSDGLSCQDINECQESSPCHQRCFNAIGSFHCGCEPGYQLKGRKCMDVNECRQNV
CRPDQHCKNTRGGYKCIDLCPNGMTKAENGTCIDIDECKDGTHQCRYNQICENTRGSYRC
VCPRGYRSQGVGRPCMDINECEQVPKPCAHQCSNTPGSFKCICPPGQHLLGDGKSCAGLE
RLPNYGTQYSSYNLARFSPVRNNYQPQQHYRQYSHLYSSYSEYRNSRTSLSRTRRTIRKT
CPEGSEASHDTCVDIDECENTDACQHECKNTFGSYQCICPPGYQLTHNGKTCQDIDECLE
QNVRCGPNRMCFNMRGSYQCIDTPCPPNYQRDPVSGFCLKNCPPNDLECALSPYALEYKL
VSLPFGIATNQDLIRLVAYTQDGVMHPRTTFLMVDEEQTVPFALRDENLKGVVYTTRPLR
EAETYRMRVRASSYSANGTIEYQTTFIVYIAVSAYPY
Download sequence
Identical sequences ENSGGOP00000017179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]