SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017283 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017283
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-43
Family Dual specificity phosphatase-like 0.0000000573
Further Details:      
 
Domain Number 2 Region: 154-315
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.57e-36
Family PLC-like (P variant) 0.000000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017283   Gene: ENSGGOG00000000893   Transcript: ENSGGOT00000022479
Sequence length 369
Comment pep:known_by_projection chromosome:gorGor3.1:10:100901287:100990147:1 gene:ENSGGOG00000000893 transcript:ENSGGOT00000022479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHN
PPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDF
YGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQ
FVVCQLKVKMYSSNSGPTRREDKFMYFEFPQLLPVCGDIKVEFFHKQNKMLKKDKMFHFW
VNIFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKAN
RHFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDE
DQHTQITKV
Download sequence
Identical sequences ENSGGOP00000017283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]