SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017298 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017298
Domain Number 1 Region: 27-258
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.11e-72
Family Eukaryotic proteases 0.0000000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017298   Gene: ENSGGOG00000026032   Transcript: ENSGGOT00000029293
Sequence length 264
Comment pep:known_by_projection chromosome:gorGor3.1:17:42191458:42201310:-1 gene:ENSGGOG00000026032 transcript:ENSGGOT00000029293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKFSSFSLFFLIVGAYMTHVCFNMEIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQ
WVLTAAHCQYWFTKSQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLV
KLQTAAKLNKHVRMLHIRSKTSLRSGTKCEVTGWGATNPDSLRPSDTLREVTVTVLSRKL
CNSQSYYNRDPFITKDMVCAGDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKP
GIYTLLTKKYQTWIKSNLVPPHTN
Download sequence
Identical sequences G3RND2
XP_004058889.1.27298 ENSGGOP00000017298 ENSGGOP00000017298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]