SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017299 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017299
Domain Number 1 Region: 330-425
Classification Level Classification E-value
Superfamily Immunoglobulin 3.58e-27
Family I set domains 0.00031
Further Details:      
 
Domain Number 2 Region: 228-324
Classification Level Classification E-value
Superfamily Immunoglobulin 3.8e-25
Family I set domains 0.00044
Further Details:      
 
Domain Number 3 Region: 25-118
Classification Level Classification E-value
Superfamily Immunoglobulin 6.83e-23
Family I set domains 0.00000471
Further Details:      
 
Domain Number 4 Region: 121-225
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000685
Family I set domains 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017299   Gene: ENSGGOG00000013781   Transcript: ENSGGOT00000028977
Sequence length 493
Comment pep:known_by_projection chromosome:gorGor3.1:19:52082897:52089533:1 gene:ENSGGOG00000013781 transcript:ENSGGOT00000028977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEFRL
YREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSHTAGRSEPSDPLELVTTC
GKPRLSTTTGPLALEGTNPANILILXXXXGSQVAFDSFILCKEGEDEHPQCVNSQSHTLG
WSWAIFSVSPVNPSRRWSYRCYAYDSSSPYVWSLPSDLLELLVLGVSKKPSLSVQPGPIV
APEESLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSRSHGGQYR
CYGAHNLSSEWSAPSDPLDILITGQIHAIPSLSVQPGPTVVSGENVTLLCQSQGGMHTFL
LTKEGAADVPLRLRSKYQSHKYQAEFPVGPVTSAHAGTYRCYGSLNSNPYLLTHPSEPLE
LVVSGAAETLSPPQNKSDSKAGAVNTLSPSQNNLASHPQDYTVENLIRMGIAGLILVVLG
ILLFEAQHSQRSL
Download sequence
Identical sequences ENSGGOP00000017299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]