SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017313 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017313
Domain Number 1 Region: 15-116
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.64e-27
Family Canonical RBD 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017313   Gene: ENSGGOG00000013594   Transcript: ENSGGOT00000028879
Sequence length 285
Comment pep:known_by_projection chromosome:gorGor3.1:2b:86103677:86157315:-1 gene:ENSGGOG00000013594 transcript:ENSGGOT00000028879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVK
EVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSS
IMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPVYQQPA
YHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLTETS
VPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKKRTILDIYI
Download sequence
Identical sequences ENSGGOP00000017313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]