SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017424 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000017424
Domain Number - Region: 80-119
Classification Level Classification E-value
Superfamily LysM domain 0.00746
Family LysM domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017424   Gene: ENSGGOG00000014741   Transcript: ENSGGOT00000028759
Sequence length 296
Comment pep:known_by_projection chromosome:gorGor3.1:15:79792782:79798772:-1 gene:ENSGGOG00000014741 transcript:ENSGGOT00000028759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHKELLTKTFQGPAVVCGTPTSHVYMFKNGSGDSGDSSEEESHRVVLRPRGKERQKSGV
HQPHQAGAGDVVLLQRELAQEDSLNKLALQYGCKVADIKKVNNFIREQDLYALKSVKIPV
RNHGILTETRKELKPLLSPSSETTVTVELPEADRAGAGTGAQAGQLMGFFKGIDRDIERA
VQSEIFLHESYCMDTSHQPLLPAPPKTPMDGADCGIQWWNAVFIMLLIGIVLPIFYLVYF
KIQASGETPNSLNTTVIPNGSMAMGTVPGQAPRLAVAVPAVTSADSQFSQTTQTGS
Download sequence
Identical sequences A0A2I2YGR1
ENSGGOP00000017424 XP_018866489.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]