SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017467 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017467
Domain Number 1 Region: 466-701
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.87e-78
Family Eukaryotic proteases 0.00000002
Further Details:      
 
Domain Number 2 Region: 268-369
Classification Level Classification E-value
Superfamily Kringle-like 8.46e-38
Family Kringle modules 0.0000104
Further Details:      
 
Domain Number 3 Region: 165-265
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-37
Family Kringle modules 0.0000043
Further Details:      
 
Domain Number 4 Region: 81-164
Classification Level Classification E-value
Superfamily Kringle-like 2.27e-35
Family Kringle modules 0.00000554
Further Details:      
 
Domain Number 5 Region: 1-81
Classification Level Classification E-value
Superfamily Kringle-like 7.25e-34
Family Kringle modules 0.0000047
Further Details:      
 
Domain Number 6 Region: 364-464
Classification Level Classification E-value
Superfamily Kringle-like 8.7e-34
Family Kringle modules 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017467   Gene: ENSGGOG00000016065   Transcript: ENSGGOT00000030387
Sequence length 702
Comment pep:known_by_projection chromosome:gorGor3.1:6:161733744:161797835:-1 gene:ENSGGOG00000016065 transcript:ENSGGOT00000030387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DCYHGDGQSYRGSFSTTVTGRTCQSWSSMTPHWHQRTTEYYPNGGLTRNYCRNPDAEISP
WCYTMDPNVRWEYCNLTQCPQDCYHGDGQSYRGSFSTTVTGRTCQPWSSMTPHWHQRTTE
YYPNGGLTRNYCRNPDAEIRPWCYTMDPSVRWEYCNLTQCPAPTENSPGVQDCYRGDGQS
YRGTLSTTITGRTCQSWSSMTPHWHRRIPLYYPNAGLTRNHCRNPDAEIRPWCYTMDPSV
RWEYCNLTQCPVTESSVLTTPTVAPVPPTEQTPVVQQCYHGNGQSYRGTFSTTVTGRTCQ
SWSSMTPHRHQRTPENYPNDGLTGNYCRNPDSGKQPWCYTTDPCVRWEYCNLTRCSDTEG
TVVTPPTVIRVPSLEAPSEQDCMFGNGKGYRGKKATTVTGMPCQEWAAQEPHRHSNFIPG
TNKWAGLEKNYCRNPDGDINGPWCYTMNPRKLFDYCDIPLCASSSFDCGKPQVEPKKCPG
SIVGGCVAHPHSWPWQVSLRTRFGKHFCGGTLISPEWVLTAAHCLKKSSRPSSYKVILGA
HQEVNLESHVQEIEVSRLFLEPTQADIALLKLSRLAVITDKVMPACLPSPDYMVTARTEC
YITGWGETQGTFGTGLLKEAQLLVIENEVCNHYKYICAEHLAGGTDSCQGDSGGPLVCFE
KDKYILQGVTSWGLGCARPNKPGVYARVSRFVTWIEGMMRNN
Download sequence
Identical sequences ENSGGOP00000017467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]