SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017534 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017534
Domain Number 1 Region: 33-97
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000013
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 2 Region: 140-221
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000317
Family S100 proteins 0.085
Further Details:      
 
Domain Number 3 Region: 227-268
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000262
Family VWC domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017534   Gene: ENSGGOG00000023678   Transcript: ENSGGOT00000032189
Sequence length 307
Comment pep:known chromosome:gorGor3.1:3:119974208:119995191:-1 gene:ENSGGOG00000023678 transcript:ENSGGOT00000032189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQWQTWVWVLQIVIVLYNVSEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPH
KRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDEL
RRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAINI
TTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYA
DGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKTK
RVSTKEI
Download sequence
Identical sequences ENSGGOP00000017534 ENSGGOP00000017534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]