SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017559 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017559
Domain Number 1 Region: 32-141
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000013
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017559   Gene: ENSGGOG00000025039   Transcript: ENSGGOT00000026378
Sequence length 179
Comment pep:novel chromosome:gorGor3.1:20:1717024:1730474:-1 gene:ENSGGOG00000025039 transcript:ENSGGOT00000026378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPILASWPHPPGPFLLLTLLLGLTGVAGEELQVIQPEAFVSVAAGEMATLNCTVTSLLPV
GPIQWFRGAGPGQKLIYSPKGCHSPRVTTISDQRKRNSTDYPIRISSTTLKDAGTNYCVK
LRRAIPANVEIKSGPGTQMSVRVRVPAPTASLLLGLLLGSKVLLLVDVTDAYVHRKQKA
Download sequence
Identical sequences ENSGGOP00000017559 ENSGGOP00000017559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]