SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017592 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017592
Domain Number 1 Region: 103-310
Classification Level Classification E-value
Superfamily Fibronectin type III 6.57e-42
Family Fibronectin type III 0.00000822
Further Details:      
 
Domain Number 2 Region: 608-787
Classification Level Classification E-value
Superfamily Fibronectin type III 2.18e-33
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 3 Region: 371-513
Classification Level Classification E-value
Superfamily Fibronectin type III 3.36e-31
Family Fibronectin type III 0.00089
Further Details:      
 
Domain Number 4 Region: 514-613
Classification Level Classification E-value
Superfamily Immunoglobulin 3.24e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 2-107
Classification Level Classification E-value
Superfamily Immunoglobulin 4.83e-17
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017592   Gene: ENSGGOG00000014691   Transcript: ENSGGOT00000029332
Sequence length 1126
Comment pep:known_by_projection chromosome:gorGor3.1:21:28636910:28786837:-1 gene:ENSGGOG00000014691 transcript:ENSGGOT00000029332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPAMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRWEKEDRIINPEMARYLVSTKEVGEE
VISTLQILPTVREDSGFFSCHAINSYGEDRGIIQLTVQDGAEPPDPPEIEIKDVKARTIT
LRWTMGFDGNSPITGYDIECKNKSEKQNPKDSWDSAQRTKDVSPQLNSATIIDIHPSSTY
SIRMYAKNRIGKSEPSNELTITADEAAPDGPPQEVHLEPISSQSIRVTWKAPKKHLQNGI
IRGYQIGYREYSTGGNFQFNIISVDTSGDSEVYTLDNLNKFTQYGLVVQACNRAGTGPSS
QEIITTTLEDGYSQHPPPNSRVQMMAGWVMAWHRDSQWGQSGKMSRNGLRSGILFSCSCP
PELGEIKNITTTQPSLELDGLEKYTNYSIQVLAFTRAGDGVRSEQIFTRTKEDVPGPPAG
VKAAAASASMVFVSWLPPLKLNGIIRKYTVFCSHPYPTGQPVISEFEASPDSFSYRIPNL
SRNRQYSVWVVAVTSAGRGNSSEIITVEPLAKAPARILTFSGTVTTPWMKDIVLPCKAVG
DPSPAVKWMKDSNGTPSLVTIDGRRSIFSNGSFIIRTVKAEDSGYYSCIANNNWGSDEIV
LNLQVQVPPDQPRLTVSKTTSSSITLSWLPGDNGGSSIRGYILQYSEDNSEQWGSFPISP
SERSYRLENLKCGTWYKFTLTAQNGVGPGRISEIIEAKTLGKEPQFSKEQELFASINTTR
VRLNLIGWNDGGCPITSFTLEYRPFGTTVWTTAQRTSLSKSYILYDLQEATWYELQMRVC
NSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGLTTNEGLKMLVTISCILVGVLLLFV
LLLVVRRRRREQRLKRLRDAKSLAEMLMSKNTRTSDTLSKQQQTLRMHIDIPRAQLLIEE
RDTMETIVDDRSTVLLTDADFGEAAKQKSLTVTHTVHYQSVSQATGPLVDVSDARPGTNP
TTRRNAKAGPTARNRYASQWTLNRPHPTISAHTLTTDWRLPTPRAAGSVDKESDSYSVSP
SQDTGVDRARSSMVSTESASSTYEELARAYEHAKMEEQLRHAKFTITECFISDTSSEQLT
AGTNEYTDSLTSSTPSESGICRFTASPPKPQDGGRVMNMAVPKAHR
Download sequence
Identical sequences ENSGGOP00000017592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]